2018-09-15: Great baseball, surprise seats for mom’s birthday

2018-09-13: Isn’t it funny that we use our thumbs to send a 👍 emoji?

2018-09-12: Pocket Camera Microcast 1 — Thoughts On The iPhone XS A new microcast for Pocket Camera on the iPhone XS

2018-09-12: What could the new iPhone X camera have? We’ll find out soon. What I want in the new iPhone camera — …

2018-09-10: 2018-09-08 Beautiful weekend trip to Michigan’s Upper Peninsula. 2018-09-09

2018-09-05: Wonderful walk in our end of summer

2018-09-03: I’m going to announce this tomorrow, but want to drop it here first. I’m excited to announce a …

2018-09-03: A sunrise photo to celebrate the release of the latest version of Sunlit. Cheers @manton and Co.!

2018-09-03: Is it just me, or does it seem to take a really, really, really long time to get the log in emails …

2018-09-03: Microcast 4: Announcing a new project: Pocket Camera I’m excited to announce something I’ve been working on this summer: Pocket Camera! A website focused …

2018-09-02: One of the most vivid clouds I’ve seen

2018-08-20: Is anyone interested in having Micro.blog on Buffer? I reached out to them on Twitter and they asked …

2018-08-18: I was awoken Friday morning to a bat trying to snuggle. I got it out but realized the baby could …

2018-08-12: There’s no better feeling than waking up and the only thing you need to do for the day is go …

2018-08-09: I wonder what Sun Ra would have thought of this “Space Force”

2018-08-07: I’m seriously thinking of using something like Jamf for managing all my devices and devices in my …

2017-11-12: Starting to use Overcast for audiobooks… really excited to see what Smart Speed has to offer for …

2017-11-12: Starting to use Overcast for audiobooks… really excited to see what Smart Speed has to offer …

2017-11-11: Squares t.co/PTHrNuTp3…

2017-11-11: Squares

2017-11-10: Fall mornings in Kalamazoo t.co/wh3TgTWFb…

2017-11-10: Fall mornings in Kalamazoo

2017-11-08: We get a Wednesday night game to boost TV rankings and the “talent” accidentally says we Row the …

2017-11-08: Wow is right… they are reshooting a film that has had trailers. t.co/8qNFNhO3I…

2017-11-08: Still not enough characters to quote the first lines of Emily Wilson’s new translation of The …

2017-11-06: Beer garden, fully Fall t.co/R2AGffHln…

2017-11-06: Beer garden, fully Fall

2017-11-06: Beer garden in full bloom

2017-11-04: Making chili… t.co/qCYCMhcDp…

2017-11-04: Making chili…

2017-11-02: No filter Fall

2017-11-01: Wow. Talk about one upping your own MVP award. That was beautiful

2017-11-01: My boys t.co/guOdOcH4B…

2017-11-01: Way to go JV, way to go Astros.

2017-11-01: Ok @MichiganGonzo @TimMartinMI @ChrisGautz you can make fun of me and the Broncos now

2017-11-01: If the Broncos lose to Central and no fans are in the stands do they really lose?

2017-11-01: #WorldSeriesGame7 has me all like t.co/pYtbCNTvp…

2017-11-01: Finally they mentioned Larry King in the celeb round up! #worldseries t.co/aRcdAE38C…

2017-11-01: I hope so t.co/mIK42h2r3…

2017-11-01: Last dual screen night of the season…

2017-11-01: Wowza Astros

2017-11-01: How could I forget the fired up @ChadLivengood! t.co/heq103InH…

2017-11-01: To my favorite Chips @MichiganGonzo @TimMartinMI @ChrisGautz — #GOBRONCOS!

2017-11-01: Here’s a better shot t.co/VbZBvvD34…

2017-11-01: Wow. No one is there. Good for the students — IT’S A SCHOOL NIGHT t.co/vr9Pgfmk9…

2017-11-01: Has anyone seen a crowd shot of the #WMUvsCMU game on TV yet?

2017-11-01: RIP #MyronNoodleman. Loved seeing you at @LansingLugnuts games, was hoping to catch you at the …

2017-10-31: I don’t think I’ve ever handed out Halloween candy.

2017-10-31: This has all the makings of a great baseball game tonight.

2017-10-31: Looks like Buster is wearing a costume too #bringbusterback t.co/GIgl0kiqg…

2017-10-31: #KingCrimson in Washington DC: Timeless music in a city of drivel, my take. @DGMHQ …

2017-10-30: King Crimson in Washington DC: Timeless music in a city of drivel Tony Levin was right: something changed about King Crimson in Mexico City earlier this year. He …

2017-10-30: Goodbye Gene the Jeanie. May your magic work on other teams!

2017-10-30: 😭😭😭 t.co/jhrCK2eOk…

2017-10-30: A strange bug or feature on my Apple Watch Inconsistencies with Watch Face Display Time Ahead on the …

2017-10-30: A strange bug or feature on my Apple Watch Inconsistencies with Watch Face Display Time Ahead on the …

2017-10-30: Inconsistencies with Watch Face Display Time Ahead on the Apple Watch [caption id=“attachment_1143” align=“alignright” …

2017-10-30: Woah t.co/KQBpgj8Ge…

2017-10-29: Wow what an amazing show from @DGMHQ — very different from last night. Loved the middle section of …

2017-10-29: Ready for night two! t.co/Jvt0SCIsq…

2017-10-29: This has been the case at every KC show I’ve seen. Tonight will be no exception. …

2017-10-28: I’ve never been so excited to not have my camera: King Crimson in concert

2017-10-28: I’ve never been so excited to not have my camera: King Crimson in concert Getting ready to see King Crimson again tonight, first of two in Washington DC. So fortunate to be …

2017-10-27: Just arrived in DC. It’s beautiful here

2017-10-27: Walking on air

2017-10-27: DC bound

2017-10-27: DC bound t.co/qInjkZmrp…

2017-10-25: Really what is this game?

2017-10-25: CAM WAS ALWAYS MY HERO BUT NOW HE’S MY TACO HERO

2017-10-25: CAM MAYBIN GOT US ALL A FREE TACO THANK YOU

2017-10-25: Wait what was JV doing? He’s in the locker room?

2017-10-25: Let’s do this Cam!

2017-10-25: This game is wild. Such good baseball

2017-10-25: Extra inning = extra beer

2017-10-25: THIS IS UNBELIEVABLE

2017-10-25: Per tradition, cracking open a beer for extra innings t.co/RL57Ox1C0…

2017-10-25: Per tradition, cracking open a beer for extra innings.

2017-10-25: Can’t wait to read this… AFTER I see them this weekend in DC! #nospoilers …

2017-10-25: What a great moment t.co/xJxNPbst6…

2017-10-25: Interesting… higher price to buy, less support needs over time t.co/hITzuQevn…

2017-10-25: Wait did they just go through all the celebs at the game but didn’t mention Larry King who’s visible …

2017-10-25: Am I a bad King Crimson fan for enjoying hearing them sampled in Kanye’s Power during the …

2017-10-25: Am I a bad King Crimson fan enjoying hearing them sampled in Kanye’s Power during the #WorldSeries …

2017-10-25: Did that ball hit him in the face?

2017-10-25: Yeah JV!

2017-10-25: That was classic baseball right there.

2017-10-25: Wow. This is amazing.

2017-10-25: Fall in Michigan.

2017-10-24: It’s magical how your home can transform when the weather turns cold. It becomes a place of comfort, …

2017-10-24: Wow. First pitch of the World Series. Home Run.

2017-10-24: Wow. First pitch of the World Series. Home Run.

2017-10-24: This week This is something new I’m trying… a weekly post of the different things I’ve read and done. …

2017-10-21: What would JV be doing right now if he stayed in Detroit?

2017-10-21: MVP!!!

2017-10-21: Yaaaaaaaaaaaaaaaaasaaaay!!!

2017-10-21: Hahahaha the Yankees paid McCann? And he hit a two run double. Hahahaha So funny. #momoneymoproblems

2017-10-21: ⭐️🔥⭐️🔥⭐️ 🔥⭐️🔥⭐️

2017-10-21: ⭐️🔥⭐️🔥⭐️

2017-10-21: Hope this gives the Astros the “upper hand” … Ha ha ha t.co/6uLmps0yc…

2017-10-21: I’ve always wondered if #kalamazoo has a higher percentage of #Yankees fans than other Michigan …

2017-10-21: This makes me appreciate @PAWSDetroit even more t.co/qhSnmvXSk…

2017-10-21: Oh no t.co/8u0ali2uc…

2017-10-21: Game 7!

2017-10-21: Colonel Sparty didn’t like that call #msu #michiganstate #msu t.co/8bQI4RrFZ…

2017-10-21: Is Sweetest Day the precursor to Halloween? The beginning of a Lenten or Advent season but for …

2017-10-21: This is… unbelievable t.co/ObtH4s9xp…

2017-10-21: And a @WesternMichU alumna! Had the pleasure to interview her on graduation day in 2009 …

2017-10-20: I wish there was an option that, if you rent a movie, you can upgrade to purchase it within a day. …

2017-10-20: Latin and Greek t.co/iu7cQHfuw…

2017-10-20: And why did they take JV out???

2017-10-20: Stayed in Wrigleyville too. Sad night for the Cubbies, but amazing to see everyone come out

2017-10-20: Saw The War on Drugs last night in Chicago. Great to see such a great band live — was always …

2017-10-20: So excited… and I want to read it. But holding off until DC next week so I don’t see any set …

2017-10-19: Oh no — I hope everything is OK t.co/pCQutqMeI…

2017-10-17: If my grandpa was alive, he’d rail against the replay. “Those guys in New York can’t tell us how to …

2017-10-17: This has been a strange night of baseball. Both games.

2017-10-17: Stuck in the ivy????

2017-10-17: That was a crazy end to the 4th

2017-10-17: It’s amazing that Apple still sells this…. Apple iPhone Bluetooth Travel Cable …

2017-10-17: How cool was would it be to have sport scores for select teams appear on the Apple Watch Siri face

2017-10-17: P.S. @getlibris – I never wanted a fidget spinner but now I’m all about it and …

2017-10-17: Thanks for the sweet swag box, @getlibris. Can’t wait to hear how the #twohearted homebrew goes! …

2017-10-17: I’ve really started to appreciate candles. The past few weeks I’ve come home and lit a large candle, …

2017-10-16: The Eccentric Café

2017-10-16: That Justin Verlander… what a good guy

2017-10-16: Really cool program from the Brewers Association. It’s important to highlight true independent …

2017-10-16: I’m joining the movement to #TakeCraftBack! Great project from @BrewersAssoc – thank you …

2017-10-16: Hello there – got a pretty neat new addition to my dock. Hello Micro.blog on the Mac!

2017-10-15: What great October baseball… so many former Tigers!

2017-10-15: Loving this October baseball

2017-10-15: What great October baseball… so many former Tigers!

2017-10-15: What a wonderful October this has been for baseball.

2017-10-15: October baseball Throughout the season, I always forget how great October baseball is. And now that my Tigers has no …

2017-10-15: Will the game be streamed anywhere? t.co/7JicqyNWS…

2017-10-14: Stunning t.co/Q4lTFVDJQ…

2017-10-14: What’s a zip anyway?

2017-10-14: So how are they going to play this game? t.co/nLZZRzCI1…

2017-10-14: Too bad we don’t #RowTheBoat anymore. Ha ha ha ha ha t.co/6ccAfcScE…

2017-10-14: Just got a package from @DGMHQ — #KingCrimson live in Chicago! Great to relive such an amazing …

2017-10-12: One thing I love about the Postseason is that t.co/DLPUsiakH… has multiple camera angles. …

2017-10-09: It’s been kinda fun watching all the former Tigers play today

2017-10-07: All smiles

2017-10-07: What’s going on with this ad??? t.co/6TXIQkOUl…

2017-10-07: 7 OTs wowowowowow

2017-10-07: Who should win the WMU/Buffalo game?

2017-10-07: 6 OT

2017-10-07: SHUT UP

2017-10-07: 5 ot? This is crazy!

2017-10-07: Busy day for screens t.co/mtmQXYFpI…

2017-10-07: Lolz. And we thought this WMU game would be done before the UM/MSU game

2017-10-07: What happened during that WMU game?

2017-10-05: #TwoHearted is the most checked-in #craftbeer for summer 2017 on @untappd! 🍻❤️❤️ …

2017-10-05: Hey @deb_klug — @UpperHandBeer in #Kalamazoo!!!!!! t.co/1VrMz7FLf…

2017-10-04: 👏 JD!

2017-10-04: What an amazing Wild Card game tonight!

2017-10-04: Oh happy day — @YouTubeTV is now in #Kalamazoo!

2017-10-03: The Empire Strikes Back

2017-10-03: YOU KNOW WHO ELSE WERE TWINS? LUKE AND LEIA SKYWALKER BABY! BEAT THE YANKEES EMPIRE!!!

2017-10-03: Gross: #StarWars Throne Room theme is playing when the @Yankees take the field. They are not Rebels …

2017-10-03: What an amazing National Anthem

2017-10-03: .@AdamBitely are you hearing this???

2017-10-03: They’re playing the Star Wars theme. 🤢

2017-10-03: Hearing these ESPN guys talk so glowingly about the Yankees makes me want to puke

2017-10-03: Some nights, you need a frozen pizza.

2017-10-02: .@UpperHandBeer — I found a #UpperHand smuggler in #Kalamazoo this morning. What should I do? …

2017-10-02: Heartbreaking news from Las Vegas

2017-10-01: So great to have #CurbYourEnthusiasm back. That was amazing.

2017-10-01: Ah man, Jim Price is going to make me cry

2017-10-01: And Brad, I never really liked you. I acknowledge you came in at a strange time. But thanks for …

2017-10-01: And the season is over. Thanks for everything, #tigers, while it was pretty crummy there were many …

2017-10-01: Last Tigers game of the year…. even bad baseball is still baseball (my new mantra)

2017-09-22: #Genie4Tigers t.co/JRvaCNK7C…

2017-09-22: With Brad gone, I want Gene LaMont as manager. Gene the Genie will make all of our wishes come true! …

2017-09-22: As much of a fan of Ausmus I wasn’t, this is true. t.co/rU1zCKJEq…

2017-09-21: I’ve been waiting years to play this game. Tonight! The Witness: The celebrated puzzle adventure is …

2017-09-21: Good looking local man. #BringBackBuster t.co/Fm3CyeFzm…

2017-09-20: 1000 supporters! Let’s keep it going! Fight on, fight on for Buster! Sign the petition: …

2017-09-19: Let’s save @wmubusterbronco and bring back the classic style we all love! @wwmtnews @Kzoo_Gazette …

2017-09-19: The petition is picking up steam! Let’s bring back #BusterBronco #notmybuster t.co/gNOljaFvC…

2017-09-19: With iOS 11 out today, learn how it lead me to lie to my iPhone. t.co/xFygkrANE…

2017-09-19: Lying to my iPhone: Driving with “Do Not Disturb While Driving” I have a confession to make: I’ve been lying to my iPhone. I never thought I would be in situation, …

2017-09-17: Join me and let’s bring back the classic Buster Bronco! #notmybuster t.co/axQu5UFbh… …

2017-09-16: This is how I will always remember you, Buster Bronco t.co/HT1otrWcL…

2017-09-16: Buster looks terrifying. Like a velociraptor t.co/U01gowts0…

2017-09-16: That’s not Buster t.co/FgZcFL8BR…

2017-09-16: Oh no t.co/iCOxLvgNO…

2017-09-16: *Schuette t.co/rkFGRIxDZ…

2017-09-16: I’m nervous about @wmubusterbronco’s makeover. t.co/9KI078s3a…

2017-09-14: And I’m proud to be working for Michigan’s oldest brewery. Thank you Larry and everyone at …

2017-09-12: Did Dan Dickerson just say JV was pitching for the Tigers tonight? Old habits….

2017-09-11: There’s never ever ever ever ever been a tweet like @VeggieTales t.co/fNw9wm70S…

2017-09-11: It’s that time when a new iOS comes out, I’ve been running the beta all summer and can’t remember …

2017-09-11: What an inexperienced outfield we have

2017-09-08: Bravo @sparksofficial — “Hippopotamus” is an amazing album. Warms my heart and gives me a smile. …

2017-09-07: I don’t know about you, but I’m celebrating #907 Day! t.co/vl6Do14s6…

2017-09-05: Watching Back to the Future at @BellsBrewery @EccentricCafe — and it’s reminding me a lot of …

2017-09-04: I am so excited to rewatch the previous 16 hours after what we saw in the last 2. And watch again. …

2017-09-04: What I’ve been thinking about more than anything is how much work it took for the characters to get …

2017-09-04: Think about everything that happened in the first few parts. All the characters. It seems so far …

2017-09-04: 24 hours after the #twinpeaks finale, I’m left with this: what an amazing and long journey …

2017-09-04: What about Leia? I’d do that if I was royalty. t.co/KQ8voK1jy…

2017-09-04: Gene Lamont for #Tigers manager. Genie will grant us our wishes! t.co/BZgcMvAqb…

2017-09-04: I’d be OK with it if they gave me the latest iPhones, iPads, Apple Watches and computers. …

2017-09-04: This is fun Fantasy Map: Roman Roads in 125AD as a Subway Map… t.co/j6VjuoFKE… …

2017-09-03: That was amazing. Everything. Still as thirsty and curious as after the first two parts. #TwinPeaks …

2017-09-03: Ready #TwinPeaks t.co/EUnHnwZtC…

2017-09-03: I can’t believe it’s tonight! Thank you @DAVID_LYNCH @mfrost11 @SHO_TwinPeaks for bringing back …

2017-09-03: Thank you @ThatsOurWaldo for making this! t.co/5ZfJsogQZ…

2017-09-03: Deciding what beer to have during the #twinpeaks finale… something is drawing me to @BellsBrewery …

2017-09-03: It all centers around Mason, Michigan. 15 Years Later, Here’s Why A Gamer Was Duct-Taped To A …

2017-09-03: Ready for tonight’s #TwinPeaks finale with a homemade, organic cheery pie made with love, just like …

2017-09-03: Hey @Podcastellanos, what do you guys think? @ComericaEric @jordanhall23 t.co/S4kXnjnGT…

2017-09-03: .@deb_klug’s #Tigers hot take: If you have J at the beginning of your name, you need to watch out: …

2017-09-03: Some #twinpeaks inspiration before tonight’s finale t.co/1HMKnhNi6… t.co/FaIkSa6dZ…

2017-09-03: Saving Christians from Genocide: t.co/GRBRTEkXu…

2017-09-03: #Detroit Over & Under: 1910 t.co/Jo6ekpCmo… t.co/O5BwjzYdx…

2017-09-03: And it’s hilarious. This is a generic Millennial ad t.co/ThdnkKgFL… t.co/7hJTQUUV1…

2017-09-03: Oh man, this is heartbreaking. t.co/8Rv0tbPh3…

2017-09-03: A Day in Amish Country: t.co/O0NRo6Jo7…

2017-09-03: An eternal struggle: Dieting for God - Awful Library Books t.co/As6UJquxq… …

2017-09-03: A day in Amish country Spent Saturday in Amish country, about 90 minutes from where my parent’s live. Always struck by the …

2017-09-03: Now this is a Lego set I’d want to build: Malt, hops, water, yeast, and ABS – the …

2017-09-02: Well this game went in ways no one imagined. Great job #Broncos. Great start Coach Lester. Watch out …

2017-09-02: Yayayayyas

2017-09-02: Oooooooooo noooooiooooo

2017-09-02: The Trojans fell to a Greek horse once. Now it’s time to be defeated by a #WesternMichigan Bronco. …

2017-09-02: Take that Trojans.

2017-09-02: Jdkdjdkskskskdjdnsjsnsnsnnwqksndnendn BRONCOS BAYBAY

2017-09-02: Rules for life. t.co/sMOxCiSJW…

2017-09-02: Just being #Broncos #WesternMichigan t.co/gpEfQqROn…

2017-09-02: Beal baybay!!!!

2017-09-02: Nckflekenjfnkalqjehrjdknabsjdndkwnskalamsjrkekwkwmmsfkfkekwkkqmsmdnendndmdkdkwnwjsjdnmqkandndjdkwkal …

2017-09-02: Wow again Broncos

2017-09-02: Wow. I didn’t think this would be happening. GO #Broncos!

2017-09-02: Ok #Broncos, let’s do this!

2017-09-02: The kind of place where the bathrooms are labeled “ladies” and “gentlemen” and there’s two types of …

2017-09-02: Spending the day in Amish country. t.co/wu2C24Zie…

2017-09-01: Well this #Tigers game confirms all of our fears.

2017-09-01: But I like this place. When asked what sizes they have, the barista said: small, medium and large.

2017-09-01: What’s holding up the Starbucks line on the Ohio Turnpike? Three letters: PSL

2017-09-01: These downtown #Kalamazoo trains are out of control. Why do they always come during commute times?

2017-08-31: Wow

2017-08-31: JV!!!!!

2017-08-31: Holy #tigers! t.co/Jtg2rlKEX…

2017-08-31: J UP! We’re gonna miss you. #tigers

2017-08-28: Yay! I A #TwinPeaks Podcast is out! Haven’t waited all day for podcast to be released… ever. …

2017-08-27: - ) ALL

2017-08-27: That was totally worth the wait. Cheers @DAVID_LYNCH @mfrost11 @Kyle_MacLachlan @SHO_TwinPeaks! …

2017-08-25: . @RodAllen12 I see you entering the park. Can’t wait for tonight’s game #gotigers (and yes that was …

2017-08-24: Who am I kidding. I’m not going down to a basement room with a bat in it when it’s dark outside. …

2017-08-24: Wish me luck as I enter my laundry room to retrieve clothes and a bat is sleeping there 😬

2017-08-24: This is wild! t.co/42B8Jnmir…

2017-08-23: When I ask Siri the score of the #Tigers game t.co/eLLyJUeEY…

2017-08-23: Thanks for following along. I had a blast! If you have any questions or want some critiques on …

2017-08-23: A6e. Think about sharing photos that excite you and hopefully your fans follow! #SproutChat

2017-08-23: A6d. In the age of text limits, pictures get you a lot — they’re worth 1000 words! #SproutChat

2017-08-23: A6c. Photos and videos are the best way to show your culture and to connect with others. #SproutChat

2017-08-23: A6b. Sometimes, sharing a good photo, you don’t get immediate return with metrics. Think about IG — …

2017-08-23: A6a. For photos, I like tracking the number of shares on FB and retweets on Twitter. For IG, it’s …

2017-08-23: Moments happen, and you need to be ready to capture them, with or without dongles, external mics and …

2017-08-23: A6e. For a microphone, don’t cheap out! I would recommend something from @rodemics. They make the …

2017-08-23: A6d. For a full-size tripod, get something light and portable — you don’t need anything heavy duty …

2017-08-23: A6c. But if your phone is your main content device, there are two items I would recommend right …

2017-08-23: A5b. I don’t want to rely on a gadget or add on that I won’t have at all times. #SproutChat

2017-08-23: A5a. I like to travel light. Most of the time, I use what my phone has to offer. #SproutChat …

2017-08-23: Yes! Think about how people in your entire company could use the content, just not for social media …

2017-08-23: A4c. Get the content now — it’s better to overshoot today than wishing you had more tomorrow.

2017-08-23: A4b. Sometimes, the photo I think will be the best ends up not working, so I’d rather have more. …

2017-08-23: A4a. I always take more pictures and video than I think I need — you never know what will come in …

2017-08-23: Yes, this happens. I always hold the camera with my fingers — two thumbs and two pointer fingers …

2017-08-23: A4e. When you’re done shooting a video in Hyperlapse, select 1x for export and you get all the …

2017-08-23: A4d. For stabilization, use a tripod or an app like Hyperlapse from @Instagram. It has a great …

2017-08-23: A3c. Audio is the most important part of any video: if your viewer can’t hear what’s being said, …

2017-08-23: A3b. Don’t be afraid to ask someone you’re interviewing to move or go to an area where it’s not so …

2017-08-23: A3a. To conserve time, try to shoot the video in one take. The less you have to edit, the better. …

2017-08-23: Yes, as the UpJohn Co. use to say in Kalamazoo: “Keep the Quality up!” #SproutChat …

2017-08-23: A2g. Take the pictures your enjoy. If it’s something you don’t like, then others probably won’t …

2017-08-23: A2f. Most people view on their phone. If it looks good on your phone, it will look good on their …

2017-08-23: A2e. Think about where people will be looking at your content. #SproutChat

2017-08-23: A2d. I’d recommend rarely using flash. It looks unnatural and destroys the mood around you. Use …

2017-08-23: A2c. Here’s one I took from barrel sampling at @BellsBrewery. Forgot my memory card and had to use …

2017-08-23: A2b Something any photographer will tell you: It doesn’t matter what camera you have, but what …

2017-08-23: Follow good photography rules. If you’re unfamiliar, look up the “rule of thirds” and different …

2017-08-23: It also shows that you are real people taking real photos — you’re not outsourcing your photography …

2017-08-23: A1e. Content created on the go can have a more genuine and authentic feel than something staged in a …

2017-08-23: A1e. Boomerange of one of our brewing vessels at @BellsBrewery t.co/cTMicHxaH… #sproutchat

2017-08-23: A1d. Your phone can do a lot of things a regular camera cannot do, including live video, boomerangs, …

2017-08-23: A1c. Or when mowing the lawn #SproutChat t.co/z4oOfNcir…

2017-08-23: A1b. For example, I often get inspired out enjoying some of our beers. It’s great to have my phone …

2017-08-23: A1a. First: you always have your phone with you, so you can capture content at any time. #SproutChat …

2017-08-23: Oh, and greetings from Kalamazoo, Michigan! #SproutChat

2017-08-23: A little background on me: I am the digital content specialist for @BellsBrewery. Previously a …

2017-08-23: Hello #SproutChat — looking forward to talking to you about one of my favorite things today — taking …

2017-08-23: Excited to be taking part in a #SproutChat this afternoon at 3 p.m. EST about creating content on …

2017-08-22: Well @realDonaldTrump — looks like @cnn didn’t turn you off t.co/Z5IZzxTu6…

2017-08-22: This is just wow

2017-08-22: This is all so wild

2017-08-22: A more presidential speech one day, more campaign speech the next

2017-08-21: Thank you to the donors, @KalamazooCity Manager Ritsema, @hope4kzoo, Attorney Robinson and …

2017-08-21: So happy for my #Kalamazoo community — the Foundation for Excellence passed! Beyond excited about …

2017-08-21: Can’t wait! t.co/eeYcuVuCG…

2017-08-21: What a speech from Comm. Anderson. The Foundation is our “eclipsian moment” in Kzoo. …

2017-08-21: Especially those Blue Moons… t.co/pDkE09acx…

2017-08-19: Just watched Trumped — a collection from @SHO_TheCircus — and was reminded of all those times we …

2017-08-12: Mew in Detroit 2017 [embed]www.youtube.com/watch Mew has been one of my favorite bands for close to ten years. Like a …

2017-08-10: And wait, yeast isn’t one of the main ingredients? t.co/ETL8bNoTV…

2017-08-10: Ewww… rice t.co/ETL8bNoTV…

2017-08-10: The trains downtown #Kalamazoo are crazy. I wonder how much it impacts our local economy, people …

2017-08-07: Spending the day switching over to stock iOS apps to see how they’ve changed in iOS 11 — feels good …

2017-08-06: If that didn’t warm the heart of every single #twinpeaks fan I don’t know what will

2017-08-06: #TwinPeaks is the best way to end/start the week. But sometimes it gets me thinking and I cannot …

2017-08-06: The beer bloggers rapid presentations was awesome! Great work everyone 🍻👏 #bbc17

2017-08-06: Sunday morning at #bbc17 t.co/RJqEfANfp…

2017-08-05: For distributors, tap rooms are important because people will go there, try beer, and buy it at …

2017-08-05: +🍺 #bbc17 t.co/K56tqz7eb…

2017-08-05: I love hearing about the church events in Wisconsin that feature beer… Michigan needs to follow. …

2017-08-05: Yes and yes #bbc17 t.co/CcKcVG2mF…

2017-08-05: Independence is important. US has best beer market in the world, because of the regulatory system we …

2017-08-05: And as someone who is now in marketing, it’s always great when journalists ask questions and tell …

2017-08-05: “Look for a story that’s deeper, a little different, more richer than” what you’re being pitched or …

2017-08-05: Great overview of pitching and getting to the heart of a story from @WhereandBack of @BeerAdvocate …

2017-08-04: Having some ideas for future advertisements at the @BellsBrewery General Store… #bbc2017 …

2017-08-04: Does @adsteinmann know how to pour a beer? t.co/AULQwas08…

2017-08-04: Pairing food, beer & history? Sounds like a Friday night for me. Great programs from …

2017-08-04: Advice from the master, Randy Mosher himself: “You never get to the point where you know …

2017-08-04: Beer bloggers, have you ever spilled beer on your computer? (I have) (but not today) #BBC17

2017-08-04: Cont.: “What is it what you really like in the glass”… recommends blind tasting.

2017-08-04: Mosher: “Love that people rate beer, but in a lot of ways that system is flawed because people bring …

2017-08-04: His book taught me so much about beer tasting and appreciation. Now I get to see Randy Mosher in …

2017-08-04: Oh, always love hearing about my beloved centennial hop: it’s #dank! #BBC17

2017-08-04: This one too: - “Why don’t you come to our festival, it will give you so much exposure.” - “You …

2017-08-04: Gosh, such good insight here: “If it was legal to give a nonprofit free beer, all the bars in …

2017-08-04: #truth #bbc17 t.co/DDd3OWrHz…

2017-08-04: Love the @BrewersAssoc independent seal, and I know @BellsBrewery does too #bbc2017 …

2017-08-04: Great to see this numbers from @HerzMuses and @BrewersAssoc about how #craftbeer breweries give back …

2017-08-04: Hmmmmm, what’s he thinking about? #BBC17 t.co/UU2QMW6kw…

2017-08-04: Excited to be in #Milwaukee for #BBC17 with @BellsBrewery. t.co/8pSVFKwr2…

2017-08-04: Sometimes when there’s an e-mail I don’t want to reply all to, I do it on accident because I’m …

2017-08-03: This may be one of the biggest #craftbeer stories of the year — not only because of the deal itself, …

2017-08-03: Now owned by a Japanese brewery: “@AnchorBrewing bills itself as America’s ‘first and oldest’ craft …

2017-08-03: What I can’t find right now is how Sapporo ranks in the world as largest breweries.

2017-08-03: The 22nd largest craft brewer sells to the 19th largest brewery in the country, according to the …

2017-08-03: Some early morning news for ya San Francisco’s Anchor Brewing acquired by Sapporo …

2017-08-01: Shane Shane Shane!

2017-08-01: Why do they talk about the guy running on the field but not showing it? #tigers

2017-08-01: AJ still has it! #TigersAlumn t.co/5pVE3T4Kb…

2017-08-01: Who’s Hicks? Go Hicks! #tigers

2017-07-31: What else could happen today for the #Tigers? Time will tell…

2017-07-31: Oh how I’ll miss Alex, his return to Detroit was triumphant. At least two great players are …

2017-07-30: #TwinPeaks keeps getting better and better

2017-07-30: And how many people like it? Guilty pleasure of mine t.co/kxoyTUM70…

2017-07-30: If Verlander leaves, it’s his decision. t.co/gnukuyc6W…

2017-07-27: Happy Birthday, John! @BellsBrewery t.co/d7V9rKjD0…

2017-07-26: Totally agree with @BenjaminBrooks on this t.co/x1DKpoHOU…

2017-07-26: .@rallenMI on today’s #mibeer news t.co/iFhpVH8vI… t.co/FVnJQx58J…

2017-07-26: I think it skirts around what really is happening: a sale.

2017-07-26: A question I’ve had for a while given craft beer deals: Why do people use “partnership” and “sell” …

2017-07-26: From @MiBiz: Short’s Brewing to sell 20-percent stake to Heineken subsidiary Lagunitas …

2017-07-26: Wow wow t.co/hh4bdooZB…

2017-07-26: Wow

2017-07-25: Had a great time at @bycmack – and riding #bella! t.co/BgPWsxjCc…

2017-07-24: If I erupt in the next few days, here’s why #tigers t.co/JhoyUQzMk…

2017-07-24: An open letter from a nervous baseball fan the week before the trade deadline To whom it may concern, We’re days away from the trade deadline and my favorite baseball team the …

2017-07-24: How do you prepare coworkers and friends that your emotions may blow up in the days leading up to …

2017-07-24: Exciting @KalamazooCity Commission meeting tonight as the Foundation for Excellence begins to take …

2017-07-24: Interesting to lean how @evernote is using bots to help w/ customer service from @planetdorth …

2017-07-24: Reminds anyone of Kalamazoo Beer Exchange? t.co/xvrH2rDN0…

2017-07-24: Anyone having audio issues with #SproutSessions?

2017-07-24: I still get giddy every time I get @GoPro back that surprises me — even when I set the camera up!

2017-07-23: Has pie ever saved your life? #TwinPeaks

2017-07-21: Writing a book, no doubt t.co/qU5ppKmJU…

2017-07-21: Wow t.co/Vxjv2ezDm…

2017-07-19: Oh #Tigers

2017-07-19: What’s going on @wmubusterbronco?????????

2017-07-19: WHAT?!?!?! THIS IS CRAZY #SAVEBUSTER t.co/MaOeaEXwZ…

2017-07-19: Hmmmmmm, I can make robots now? Meet @SproutSocial’s Bot Builder: t.co/yP6ERArBL…

2017-07-18: JD 🤧 It’s so hard right now. I know it’s baseball. But it’s still hard.

2017-07-18: Great chatting about what’s different with social in the craft beer industry …

2017-07-17: Well, at least it wasn’t this: t.co/k5oVKxFRb…

2017-07-17: Reminding myself I can’t analyze #TigersTrade like #TwinPeaks t.co/kmwpdHoI2…

2017-07-17: Yup — I would have lower back pain too with the thought of having to move in the immediate future. …

2017-07-17: At scary moments like this, I reach for beers in the back of the fridge with high ABV. This time, …

2017-07-17: Low back tightness. Not a trade. JD is still a #Tiger… right now.

2017-07-17: Maybe JD got pulled to do that segment with @RodAllen12????? Please so it’s the reason

2017-07-17: Oh no oh no t.co/E5vDLJK3X…

2017-07-17: OH NO JD GOT PULLED FROM THE GAME

2017-07-17: YES! t.co/lnVMe4mvX…

2017-07-17: Say what you will, but it seems like team meetings work

2017-07-17: It’s fun watching the #Tigers again

2017-07-17: The #Tigers are looking great tonight @deb_klug @MichiganGonzo!!!

2017-07-17: #KingCrimson ruins everything @DGMLive t.co/kL92C5usC…

2017-07-17: I learned a lot about emoji that day… don’t know if I’ve mastered it yet 🤷‍♂️ t.co/FtuXz2MhQ…

2017-07-17: King Crimson ruins everything King Crimson ruins everything. I saw them twice this summer on tour, in Chicago and Minneapolis. The …

2017-07-17: Some really good stuff here from @SproutSocial and #SproutSessions! t.co/l7bWwmiCN…

2017-07-17: So great @DGMLive is releasing tracks from the 2017 #KingCrimson tour — Level 5 from the show I saw …

2017-07-16: At least #TwinPeaks features good musicians.

2017-07-16: No stars #TwinPeaks

2017-07-16: And just like that, the Richard Horne robbery scene was one of the most disturbing things I’ve ever …

2017-07-16: What an incredible journey we’re on. #TwinPeaks @SHO_TwinPeaks

2017-07-16: This is not a game. LAURA IS THE ONE!!! #TwinPeaks t.co/wgTlitvdu…

2017-07-16: Are not what they seem… t.co/bRr0Vhh9T…

2017-07-16: I always become incredibly nervous before a new episode of #TwinPeaks

2017-07-16: Game of what??? #TwinPeaks is on at 9 p.m.! TV that’s not playing around

2017-07-16: I love this team t.co/1gbSpXzgI…

2017-07-16: That even got Gene Lamont out of the dugout

2017-07-16: Walk off walk!!!!! hahahahahahahahahahahhahahahaha

2017-07-16: What if they walk Miggy?

2017-07-16: So slow, Gibby says, it would put a turtle to sleep

2017-07-16: Even without the extra innings, this is one long Tigers game

2017-07-16: Student facing beheading in Saudi Arabia was to attend @WesternMichU via @freep …

2017-07-15: Will @JohnnyKaneFSD go #unicorn live on @FOXSportsDet? 🦄⚾️🐅 t.co/ICaFBMswo…

2017-07-15: t.co/SiPqJBfdP…

2017-07-15: Hot new Robert Fripp diary entry: t.co/4T5r6mHKw…

2017-07-12: Wow — thank you @KalPublicSafety and @ConsumersEnergy! t.co/QYTu30c5k…

2017-07-12: Surreal – rain is pouring and the transistor fire still goes. t.co/ZEES35jhc…

2017-07-12: Power out downtown Kalamazoo — looks like lightning hit a transistor near Black Owl café

2017-07-11: It’s tough times for our beloved Detroit @Tigers. My mom @deb_klug has advice we all should follow… …

2017-07-10: Watching the #HomeRunDerby is like playing a dumb, receptive game on your smartphone, wondering …

2017-07-10: I’ve never seen lightning through the light tube at work.

2017-07-10: Wicked storms driving into Kalamazoo Country this morning, looks like they will keep up for a bit. …

2017-07-09: Thank you @DAVID_LYNCH, @mfrost11, @Kyle_MacLachlan, @SHO_TwinPeaks & everyone who brought …

2017-07-09: #TwinPeaks gets better and better

2017-07-09: When you literally dream of donuts and are in Lansing, you go to @QualityDairy, right @MichiganGonzo …

2017-07-09: Went fishing at work. t.co/ubtfqb4hH…

2017-06-28: King Crimson live in Minneapolis  The boldest sounds I’ve ever heard in my life came from the King Crimson concert in Minneapolis. It …

2017-06-22: Listening to Blondie live albums

2017-06-21: Max 💔

2017-06-21: 1 am Tigers game. It’s tied. And Avila is pinch hitting. Let’s go.

2017-06-19: Congratulations to everyone I work with at Bell’s. Our commitment to quality in everything we do …

2017-06-16: Wow — this is crazy! Amazon to buy Whole Foods Market in deal valued at $13.7 billion …

2017-06-16: It’s backed up all the way to Rose St. Avoid! Glad I walked

2017-06-16: Train causing major back up on Michigan ave again

2017-06-13: Damn, #tigers t.co/c9eZaIE2o…

2017-06-13: What an amazing play Miggy!!!!!!!

2017-06-12: Basketball is much longer and played much later than I remember. And they get days off between …

2017-06-06: Do you ever think you’ve misspelled a word when writing it our in a different font?

2017-06-04: Wow, interesting juxtaposition in my timeline t.co/xV9sdWJxD…

2017-06-02: Woah t.co/E1QnIgoIC…

2017-06-02: My mom @deb_klug on Nick Castellanos’ jumping catch against Frazier: take that @Podcastellanos!

2017-05-31: Guys…. what about Slows?

2017-05-31: Ah, good #Tigers

2017-05-30: There’s baseball in Kalamazoo? Count me in. Go @kzoogrowlers! Fourth Opening Day of the season! …

2017-05-30: .@KzooPorter what are you doing at Hardings! Don’t you have a game tonight? t.co/8yahB1XGu…

2017-05-29: This makes sense: Bigger wine glasses make us drink too much, says researcher (the guardian) …

2017-05-28: I hope Cooper is coming back to reclaim the thumbs up from @realDonaldTrump. It’s a sign of good, …

2017-05-28: Oh no #Tigers t.co/yGtAzntSJ…

2017-05-28: Fascinating and brief history: America’s State Capitols: An Architectural Explainer …

2017-05-27: Fascinating history: Craft-beer hop farm in Stó:lō territory slated to be one of Canada’s …

2017-05-27: 🙏 Pope: More Christian martyrs today than in ancient times t.co/lJA0DSK63…

2017-05-27: Yakima produces more than hops… Most of the World’s Bread Clips Are Made by a Single …

2017-05-25: The best donuts are the ones you don’t plan on eating. My wisdom for today. Agree @MichiganGonzo?

2017-05-25: Hey @AppleSupport — I get this error every time I try to export from iCloud Photo Library. What’s …

2017-05-24: Such a scary scene. Praying everyone is OK. Thank you to @KalPublicSafety and Life EMS for quick …

2017-05-24: I’ve never seen anything like this. t.co/zL4MDlzuq…

2017-05-24: I’ve never seen anything like this. t.co/BoxrK30Xb…

2017-05-24: I pray that everyone is OK

2017-05-24: Oh my goodness. A crash into a Metro Bus on the intersection of South and Oakland …

2017-05-24: Something is going on in #Kalamazoo — 10 KDPS cruisers just came flying down Lovell

2017-05-24: So excited to see this app released. Was a big fan of Hourly News. t.co/M8WcGrzpa…

2017-05-24: One of my favorite brands, such a cool article: How Anker is beating Apple and Samsung at their own …

2017-05-22: #TwinPeaks Season 3 playlist #AppleMusic t.co/phVm6uTEy…

2017-05-21: Brilliant

2017-05-21: I can’t think of a time since college that I would make a full pot of coffee at 8:30 pm on a Sunday. …

2017-05-21: Oh nooooooooooo t.co/Hz7AUCm4C…

2017-05-21: My #TwinPeaks Season 3 predictions… coming from nothing more than my imagination: …

2017-05-21: My Twin Peaks Season 3 predictions So I’m not one for publishing my theories, but it’s so extraordinary that new Twin Peaks …

2017-05-21: Ok this might seem like a shock to a lot of people I know, but I am much more excited about new …

2017-05-21: .@meijer has the perfect sale for today @SHO_TwinPeaks #TwinPeaks #TwinPeaksPremiere …

2017-05-21: It seems like Trump is waiting for applause… must be strange for him to speak in this sitting

2017-05-18: .@sparksofficial: the new single is a new kind of church hymn.

2017-05-18: Wow, today marks 2 years at @BellsBrewery. It’s been an amazing ride so far with some of the coolest …

2017-05-16: JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD JD …

2017-05-15: Sounding annoyed never sounded so good. Great song, “What the Hell is it this Time” by …

2017-05-11: What’s @KzooPorter’s favorite donut? A bear claw 😂😂😂😂😂😂 t.co/446xkxVEg…

2017-05-06: Rewatching Twin Peaks in anticipation of the third season. Always struck by the richness of the …

2017-05-06: Rewatching Twin Peaks in anticipation of the third season. Always struck by the richness of the …

2017-05-05: One of my favorite photos I’ve taken t.co/dwy7vFgMh…

2017-05-04: May the Fourth be with you! On the hunt for Oberon Kenobi t.co/J8PLGIv8L…

2017-05-04: Wow wow wow “Lagunitas selling remaining stake to Heineken as founder Magee seeks growth for brand” …

2017-05-03: Beautiful – wish I was there! t.co/ax9PEQC4S…

2017-05-03: Beyond excited to try this. I was never a fan of straws, but the STRAW changed that. But I love my …

2017-05-02: Can’t wait to listen! It’s like he’s become a teen heartthrob …

2017-05-02: It’s so great having Avila back Sorry @caitilino

2017-05-02: One of the best I’ve ever had t.co/VBiQzBxey…

2017-05-02: One of the best I’ve ever had

2017-05-02: Don’t forget to vote today!

2017-05-01: FREE NUGGETS FOR LUNCH!!!!!

2017-05-01: Rod’s right, it’s not fun to get hit in the head

2017-05-01: V Mart’s bunt, on loop #gotigers t.co/vba1LfPNC…

2017-05-01: They’re just jealous! t.co/TzC5TmK4y…

2017-05-01: Here it is – V Mart’s first ever bunt! CC: @blessyouboys @BYBKurt t.co/EguINIh8x…

2017-05-01: Best inning of @tigers baseball this season?

2017-05-01: Bunts are now in stock at V Mart, now in aisle RBI

2017-05-01: I think we all can take some life lessons from V Mart’s bunt, beating the shift.

2017-05-01: This is some fun baseball. LOOK WHO JUST RAN TWO BASES

2017-05-01: How’s that shift working for you now????hahahahahahaha

2017-04-30: Interesting article with section about why IKEA offers food

2017-04-30: When Sox get soggy, they can’t play.

2017-04-30: Can’t wait to catch this tonight – one of the most thought provoking shows on TV …

2017-04-30: See you there, @KzooPorter. t.co/eI0gagXMF…

2017-04-30: These are the Tigers I know and love

2017-04-30: Had an amazing time at our adult prom last night – the Wizard of boOZe. t.co/nBWCG2xjX…

2017-04-30: Had an amazing time at our adult prom last night – the Wizard of boOZe.

2017-04-29: Yes Victor!!!! Now it’s time to get things started!!!

2017-04-29: Going to be interesting to see what this means for beer… Barley genome sequenced

2017-04-29: Justin Upton drops the F Bomb two games in a row, with another Mario apology. 2nd time someone has …

2017-04-28: New album cover @RodAllen12 #GoTigers t.co/cqD2sQAs4…

2017-04-28: Real baseball talk: Justin Upton says “oh fuck” after a pop fly. Mario smooths it over with an …

2017-04-28: I actually enjoy the jokes, let’s cut out commercials

2017-04-28: Oh wait – there’s a game on!

2017-04-28: Fox Sports Detroit is on fire tonight with the awkward jokes and joshing around!

2017-04-28: What a great new album from MEW! t.co/zT1u6PH4s…

2017-04-27: Really excited to try this out.

2017-04-27: Really excited to try this out.

2017-04-27: HELLO it’s time to Micro.blog

2017-04-27: Is this the list time we #RowTheBoat as Broncos?

2017-04-23: Oh Anibal…

2017-04-22: Are any streets open downtown Kalamazoo today?

2017-04-22: Went to my first ska show. Don’t know if the pushes were out of love or hate.

2017-04-20: Thank you – and I did! t.co/BV9RpqRTL…

2017-04-19: This game has broken my heart

2017-04-19: Oh no no no no

2017-04-19: So stupid

2017-04-19: RUN MIGGY RUN

2017-04-18: Watch out, here comes Avila!

2017-04-18: .@KzooPorter I can’t believe I missed you at @EccentricCafe! We need to catch up over …

2017-04-16: Amazing: John Coltrane Draws a Picture Illustrating the Mathematics of Music t.co/UI1cIZeOu… …

2017-04-14: I’ll be honest, it’s kinda therapeutic to hear all these Cleveland fans yell at Ausmus.

2017-04-14: #TheLastJedi trailer is amazing!

2017-04-12: This is exciting but also a surprise because the search was confidential, I remember the public …

2017-04-12: Welcome to WMU! t.co/KbYSonKXE…

2017-04-11: A scholar and a #ThirdCoastOldAle fan! Interesting interview with @theresamccu …

2017-04-10: Oh no… Kalamazoo River floods @kzoogrowlers baseball stadium – hope it is gone soon! …

2017-04-09: Ian Kinsler, the best Tigers GIF maker

2017-04-08: Is It Last Call for Craft Beer?, via @nytimes t.co/n9gVsDmOm…

2017-04-07: Heading to #OpeningDayDET with @AdamBitely and we’re eating some @PAWSDetroit snacks …

2017-04-06: Baseball, hot dogs, apple pie and #Oberon. t.co/Sw9lUngun…

2017-04-04: I mean, how often can you go to #OpeningDay two days in a row? #GoingToChicago again with …

2017-04-03: Gene Lamont would really appreciate this. t.co/ovLeBqV8x…

2017-04-03: I don’t care what the weather folks say – there’s sun and planned baseball. …

2017-04-03: Is it like the Titanic, where the lower decks are locked down and unable to move to the other …

2017-04-03: What in the heck is up with this? “fans holding tickets for the Upper Level will not be able to …

2017-04-03: Woke up like this… #CapsOn! Let’s go @tigers! #GoingToChicago #WhosYourTiger …

2017-04-02: Crazy that the first run scored against the Cubs post WS was from Fowler!

2017-04-02: Oh man, it looked rough for Fowler to talk about that Game 7 now not being a Cub.

2017-04-02: Oh no Tigers’ Opening Day in Chicago threatened by rain t.co/c9VJODAW1… …

2017-04-02: 1) So I noticed this morning there’s a lot of @tigers tickets available still.

2017-04-02: 2) I think they released all the ones they were holding for the for the flex plans.

2017-04-02: 3) Hope it sells out.

2017-04-02: A very good read: Laugh It Up Google t.co/LByFFdON3…

2017-03-28: Can’t wait until Monday for Opening Day!!!! @tigers, #oberon and @MichiganGonzo oh my! …

2017-03-24: There’s a hippopotamus, a hippopotamus, a hippopotamus IN MY POOL! Great work @sparksofficial!

2017-03-23: Yeah this is fun t.co/a7mV3c2kE…

2017-03-22: 🇺🇸🇺🇸🇺🇸🇺🇸🇺🇸🇺🇸

2017-03-22: Things I love hearing on the TV “Jim Leyland loves Ian Kinsler”

2017-03-22: ROAR!!!!!!!

2017-03-22: #Go2WMU for an amazing education in Classics that will take you everywhere.

2017-03-22: t.co/VjDBQ2IoK…

2017-03-22: Man, classic Leyland during his last game: “These guys are the best. Win or loose. They’re the …

2017-03-22: “Make a memory” t.co/DJ5qqp5tD…

2017-03-22: Tonight, just for one night, we can escape from the troubles we’re facing and pretend that Jim …

2017-03-22: This is it. This is huge. Go USA Go!!!!!!

2017-03-22: Huge news. Apple has acquired Workflow, a powerful automation tool for iPad and iPhone | TechCrunch …

2017-03-22: Please tell me, @Oregonian, how much time have you spent in the Great Lakes State of Michigan? …

2017-03-22: The spiritual precursor to @BellsBrewery’s #TwoHearted? Thanks for sharing, Austin. …

2017-03-21: Are there no tarps in the #WBC2017? Seriously, this rain is out of control.

2017-03-21: We all could use Jim Leyland in our dugout

2017-03-21: “Concentration and relaxation” Jimmy’s words of wisdom.

2017-03-21: What’s this guy thinking? t.co/3p0wVjOQa…

2017-03-21: Why stop a playoff game after 4 1⁄2 innings. Don’t understand these #WBC2017 rules.

2017-03-21: Oh my it’s raining hard in LA #WBC2017

2017-03-20: Great article, but the more Latin the better IMO Naming Beers in 2017 - A Tough Spot to Be In …

2017-03-19: Great game Michigan!

2017-03-18: RIP Chuck Berry. You were rock and roll. Cannot wait to hear your last album when it is released.

2017-03-17: Interesting thoughts of using a Mac vs. iPad. I’m stuck in between. The Thing about Trucks …

2017-03-17: Fascinating read. Operation London Bridge: the secret plan for the days after the Queen’s death …

2017-03-17: .@McDonalds_MI sent @AdamBitely and I 2 of their revolutionary THE STRAWs. I try it at my #Kalamazoo …

2017-03-16: Tried THE STRAW today. Going to be sharing my thoughts tomorrow on #StPatricksDay @AdamBitely …

2017-03-16: Cheers @UpperHandBeer – #DoubleRinger is fantastic. Need to come up to the UP soon. …

2017-03-16: Your @tigers, @deb_klug!!! t.co/L3KLTlucE…

2017-03-16: Something very, very exciting came in the mail today. Can’t wait to open it up… eh …

2017-03-16: Patti Smith in Royal Oak I was beyond excited to see that Patti Smith was playing Detroit again. I saw her 5 or 6 years ago …

2017-03-15: Congratulations to everyone I work with at @BellsBrewery — 7th largest craft brewery in the country! …

2017-03-14: Wilco in Kalamazoo New rule: every chance you can see Wilco play, take it. They played more than two dozen songs …

2017-03-13: My digital diary This is something new I’m trying. I haven’t found a real good place for my personal …

2017-03-13: Politics aside, would a Michigander president consider 4 to 6 inches of snow a “winter storm” and …

2017-03-11: Patti Smith was so amazing tonight in Royal Oak. Her songs and scream resonated more than ever.

2017-03-11: What a great show from @THEadrianbelew @julieslick tonight – felt intimate like a basement …

2017-03-10: #FlashbackFriday to every single March the 10th at 3 pm @sparksofficial t.co/pHEWFs6uT…

2017-03-10: One event on my calendar today… Can’t wait to see my lady soon! @sparksofficial …

2017-03-09: When the @WMUBroncos Women’s Basketball game gets down to the wire and your mom can’t …

2017-03-09: Good to be aware. Here’s how you create echo chambers on Facebook t.co/pxHZCPCNw…

2017-03-08: Can’t wait! t.co/Cpm22K9J7…

2017-03-08: What a game! Go Broncos!!!!!!!!!!

2017-03-07: This is pretty. Use Knobs And Dials To Edit Your RAW Files In Capture One Version 10 With Tangent …

2017-03-07: Sometimes, you need to take a selfie. A Professional Photographer’s Guide to Better Selfies …

2017-03-07: Good review Judging the Quality of Light t.co/mzD305ROi… t.co/5JNmaw0Rx…

2017-03-06: Normally, that would be cause for concern. But it’s the WBC. No benders here.

2017-03-06: Wait. Didn’t I watch this team play when I woke up today? t.co/r0lJX3NEo…

2017-03-06: This @WMUBroncos BB game is crazy!

2017-03-06: Well, Jack White owns a house in Kalamazoo. In the neighborhood I grew up in. See ya at Louie’s! …

2017-03-05: Went into a new restaurant for dinner last night – it was their first day open. Host asked: …

2017-03-04: Going to the home openers in less than a week. So excited for baseball to start. @MichiganGonzo …

2017-02-28: .@RepFredUpton and @POTUS @realDonaldTrump – assuming thanking him for talking about #CuresNow

2017-02-28: The rebellion started?

2017-02-28: Question of the night: will Trump try and kick out any members of Congress?

2017-02-28: Let this be a lesson about how far reaching AWS are

2017-02-26: Worst job ever – pushing Oscar winners off the stage during the acceptance speeches?

2017-02-26: Oh spring training

2017-02-26: Tigers are back on TV

2017-02-25: When you work in the beer industry and someone spills a beer on you, you’re kind of used to …

2017-02-25: First baseball gif of the year. @AdamBitely and I had fun watching the @Nationals and @Mets play …

2017-02-18: Pokémon Go trainers are back at Bronson Park

2017-02-18: DK! t.co/Vv2IAbb7G…

2017-02-18: Don Kelly is back. This season is already amazing. t.co/Q84uxY7GC…

2017-02-16: #85VIDEOS!!!!!!!!!!! t.co/3uRcvEZ7I…

2017-02-15: Proud of my company “We take all this risk for very little reward:” @BellsBrewery takes …

2017-02-15: This is great to hear t.co/0wb9hS7Sd…

2017-02-15: Understand all of this. $50k doesn’t seem like a lot but $10k a year for a scholarship is really …

2017-02-15: This is crazy! t.co/Z6GlXmoUE…

2017-02-15: This is great. I’m backing it The Iconfactory Launches ‘Project Phoenix’ Kickstarter: A …

2017-02-15: ‘Like 9⁄11 All Over Again’: Canadians Grow Fearful of Crossing the Border …

2017-02-14: This was such a fun video to work on t.co/vqsjZPXxw…

2017-02-14: THE CURSE OF WASHINGTON SQ!!!! t.co/PrjbMeXfq…

2017-02-14: Very sad to hear this, but not really surprised. Lansing Beer Exchange project is dead in Lansing …

2017-02-13: This tool from @SproutSocial lends itself to be incredibly helpful in a pinch. …

2017-02-12: So sad to hear. His legacy was felt in the newsroom. Former Kalamazoo Gazette editor James R. Mosby …

2017-02-10: Thank you for all the memories and supporting Detroit baseball. We’ll win one for you Mike. …

2017-02-10: Aren’t we all still learning Snapchat? Some good pointers here from @SproutSocial: …

2017-02-09: Forgot to add this part that was in previous drafts: delete the file after running …

2017-02-09: Spent a while tweaking this: @WorkflowHQ to add reading schedule to @todoist, based on @JoeBuhlig …

2017-02-07: I love listening to legal arguments like this…

2017-02-07: I just screamed in the office: @SproutSocial now has @instagram scheduling! t.co/L3QS8zixB… …

2017-02-05: 9 days until pitchers and catchers report

2017-02-05: So we had the craziest World Series and now the most insane Super Bowl?

2017-02-05: Man. Everyone looks exhausted.

2017-02-05: And then when it’s done… BASEBALL t.co/EhTgSXtAW…

2017-02-05: This game. Better than the ads

2017-02-05: Wowza t.co/fUhaCO7nn…

2017-02-05: 1.7 million followers t.co/2EeFmXQHv…

2017-02-05: Dogs don’t drink beer

2017-02-05: Oh man — people who support Trump’s immigration plan are going to hate ads this Super Bowl

2017-02-05: No way is he calling it “The Big Game” t.co/58khJQamd…

2017-02-05: Mom tweeted it. So I have to retweet it. Thanks for all the birthday wishes. Had a great one this …

2017-02-05: 3D Touch has gotten me back to using Swarm again

2017-02-04: Just heard this – so sad. John Wetton, Rocker With King Crimson and Asia, Dies at 67, via …

2017-02-03: Congratulations Laura! So excited for what the future of @BellsBrewery holds under your leadership! …

2017-01-30: In troubling times, journalism is more important than ever. Let’s just hope the right people read …

2017-01-30: This is amazing. t.co/az6VEHECM…

2017-01-30: It’s so nice to leave the office and there’s a little bit of daylight left

2017-01-30: Send some love in the language of beer… I may have helped out with a few of these… …

2017-01-28: Thank you Rep. @justinamash — whole thread is worth reading. t.co/uHrORZmjt…

2017-01-27: And yes, I ate one… t.co/UgDNNTIKW…

2017-01-26: On Michigan’s birthday, my argument to keep our flag as it is. I shall defend it forever. …

2017-01-26: #YOOPthereitis #YOOPthereitis #YOOPthereitis #YOOPthereitis #YOOPthereitis #YOOPthereitis …

2017-01-26: GIFs are fun t.co/Oe6OufniD…

2017-01-26: No. Facebook Begins Testing Ads in Messenger App t.co/jXRfI7uIw…

2017-01-25: Save the facts I love Archive.org even more.  twitter.com/interneta…

2017-01-25: This is telling: George Orwell’s 1984 Is Now the #1 Bestselling Book on Amazon …

2017-01-25: The Mystery of iCloud Photo Library storage: t.co/Wr9QoHrs2…

2017-01-25: The Mystery of iCloud Photo Library storage This is a curious case of photography, small iPads and the mysterious puzzle of Apple’s …

2017-01-25: Remember when images counted against your character count on Twitter?

2017-01-24: Watching Frontline… astounding to see all the worst moments of the campaign compiled. Good reminder …

2017-01-23: If this doesn’t compel you to support journalism, what will?: WH Pushes ‘Alternative Facts.’ …

2017-01-21: That was an interesting speech.

2017-01-20: Teleprompter!

2017-01-20: It’s amazing to think Biden still has stories to tell Obama

2017-01-20: It’s surreal to be seeing these images play out. Did anyone think this would happen one year …

2017-01-19: Just upgraded to an iPhone 7 – by far most impressed with Live Photos. They are just enough …

2017-01-11: It’s some BS t.co/q8cnvWdaw…

2017-01-11: First he says he will be the best job creator God has ever made… the says this is a movement …

2017-01-11: It’s always strange to hear people clap during press conferences

2017-01-09: Oh yes t.co/j3eJBe73K…

2017-01-08: Experimenting… t.co/rH1cA0tLe…

2017-01-08: Fascinating Christian blog post about Star Wars, the Force and spirituality Rogue One and the Return …

2017-01-08: Ha! Teenager buys local newspaper, vows to hold politician dad accountable t.co/UqRbWXdcn…

2017-01-08: Yum Hotdog Magic t.co/pIyMgpMD7… t.co/T6thZ7xO5…

2017-01-08: This is so great. “Someone Dubbed The Entire Chinese Bootleg of Revenge of the Sith” …

2017-01-07: Had a great burger at @EccentricCafe today! t.co/1Rui1racp…

2017-01-07: Just got a mini 2 to replace my iPad 3. Waiting for new Pros, but can’t believe I used that …

2017-01-07: Love the @kzoogrowlers t.co/n0uv1Ymrq…

2017-01-07: So about that time PJ Fleck blocked me on Twitter… t.co/HPm1wYuML…

2017-01-07: That time PJ Fleck blocked me on Twitter With news that Western Michigan University Head Football Coach PJ Fleck is leaving the Broncos for a …

2017-01-06: Former Minn coach on BTN: We want you to have some staying power, don’t just win and leave on us. …

2017-01-06: Photoshop t.co/KspV8jrso…

2017-01-06: oh no t.co/j0XoSke9q…

2017-01-06: Is PJ Fleck going to Make Minnesota Great Again? t.co/qCfkkFG77…

2017-01-06: Broncos, as we’re digesting the news about PJ Fleck, instead of #rowtheboat going forward, we …

2017-01-06: Seriously wondering with the PJ Fleck move to Minnesota– will WMU sell the #RowTheBoat …

2017-01-06: Well, it was fun while it lasted. No surprise here. Mixed feelings, but I always felt like we were …

2017-01-05: oh no t.co/FpapwQqtw…

2017-01-05: Really moving: This Frida Kahlo-themed comic explains the importance of representation …

2017-01-04: Crazy news out of Kalamazoo County last night t.co/3qyrvVyuI…

2017-01-04: Haven’t worn my Apple Watch for a couple days… nice break but I’ve missed a lot …

2017-01-03: What happened at tonight’s county board meeting? Has anyone seen a story?

2017-01-03: Great article by @rallenMI in the @freep about the growth of @BellsBrewery and #mibeer …

2017-01-02: #RowTheBoat t.co/S1PPIOV6p…

2017-01-02: So proud of my @WesternMichU @WMU_Football team today.

2017-01-02: .@wmubusterbronco!!!!! t.co/b89Ea9Hfm…

2016-12-31: Best part of 2016 ending…. we have baseball to watch in 2017!!! t.co/KqcZe6D9M…

2016-12-31: I forgot how much fun Anderson Cooper and Kathy Griffith are on NYE

2016-12-30: Holy moley

2016-12-30: Might have to pull something my dad does: turn the tv on mute. This Florida State chant is terrible.

2016-12-30: Wow

2016-12-30: For years, my mom told me to use mPerks at @meijer. A young bachelor, I did not want to be bothered. …

2016-12-29: Yes! Now #Oatsmobile will be more mobile! t.co/ZzT2F49yp…

2016-12-27: Rest in peace, dear princess. t.co/1TAECtmgc…

2016-12-26: Profound words for these times: C.S. Lewis on Equality and Our Core Misconception About Democracy …

2016-12-25: Oh no… also enjoyed his music and singing it karaoke. t.co/udzrOIzKB…

2016-12-25: Had no idea Howard Hughes was also in the beer industry t.co/gA1GREnxf…

2016-12-25: Christ is Born! Glorify Him! Merry Christmas to all my friends on this most special of days!

2016-12-24: The tradition, from years past. t.co/fmLUh55Uf…

2016-12-24: Where is this being left out? I’m Santa’s friend, Fritz, and he’s sending me to be …

2016-12-24: What John Williams Hasn’t Seen a Single Star Wars Movie t.co/Hk1RSLAHQ…

2016-12-23: It’s gonna be fun #KBW2017 t.co/vMAyHLD9E…

2016-12-23: Oh no t.co/1AJtLAWHw…

2016-12-23: Yay! t.co/xddjb2Uyh…

2016-12-22: This needs to happen just not during the holidays. t.co/0zWdcdeNe…

2016-12-22: Amazing t.co/tPSvZitWT…

2016-12-21: Fascinating interview with @Peters4Michigan about elections in Michigan. Describes how he won in …

2016-12-08: Ugh. Can barely read my fav local news site without really bad spammy pop ups that break on my …

2016-12-05: .@Coach_Fleck’s profound advice to kids during #cottonbowl pep rally. Amazing words on …

2016-12-04: Cotton is falling from the sky in Kalamazoo!!! t.co/xANYT6pqt…

2016-12-04: Join me today at 2 pm to cheer on @WMU_Football for their Bowl Announcement Watch Party. Wear …

2016-12-02: The man, the myth, the legend: @wmubusterbronco is in Ford Field. t.co/fFd6KisfF…

2016-11-29: This is amazing. Don’t miss it. One of the best sandwiches I’ve ever had. …

2016-11-29: A new “Welcome to @KalamazooCity” coming soon? t.co/I2tBBCZu0…

2016-11-28: ROUGE ONE!!! So excited! t.co/spblFoirD…

2016-11-27: So excited! t.co/2u8IjCuSN…

2016-11-26: What a game

2016-11-25: What an amazing @WMU_Football season so far. Thank you @Coach_Fleck and team – it’s …

2016-11-25: Yes!!!!!

2016-11-25: I will never forget this. Speedy recovery. #rowtheboat t.co/9hBGxhUI9…

2016-11-25: Amazing. t.co/Bx6BB26eQ…

2016-11-25: Really touching scene from Waldo. Always rowing the boat.

2016-11-25: Toledo has walkways caused problems for WMU. It ain’t over till it’s over!

2016-11-25: They just said this is the last home game for PJ Fleck…. what are they talking about? On to …

2016-11-25: Corey Davis!!!! #RTB

2016-11-25: I may not be in Bronco town, but I’m rowing the boat with a Double Brown! #rtb …

2016-11-25: What a great score to come into the game with

2016-11-25: Will the telecast of the @WMU_Football game on ESPN 2 be delayed if this basketball game goes over? …

2016-11-24: Happy Thanksgiving! t.co/i8hqDk6wE…

2016-11-24: It worked: To celebrate Thanksgiving 2016 I earned this special achievement by completing a 5K with …

2016-11-24: Nice Thanksgiving morning walk with Millie t.co/ezCprLMFE…

2016-11-24: Holiday movie idea: family comes together, internet speeds nosedive, take it from there…

2016-11-23: Rest area reads t.co/Q8z1jxa0l…

2016-11-23: Did I forget something from the @EccentricCafe? @deb_klug t.co/83BUHfNkg…

2016-11-23: Always good to keep an eye out on app deals… t.co/Dohi7w3hC…

2016-11-23: Getting ready for Thanksgiving the only way I know how. This is the beer you wanted from …

2016-11-21: Love the effort. Don’t think a lot of younger folks know the song. t.co/3RhlzMIX3…

2016-11-21: “I’ve Got A Gal in Kalamazoo” didn’t really get the #WMU crowd hyped during College GameDay…. …

2016-11-19: Haven’t seen this much excitement around Waldo since the MSU game.

2016-11-18: I don’t #FF often, but when I do, it’s the @EccentricCafe. I probably spend more time here than I do …

2016-11-18: Hanging out with some Oatsmobiles. #Oatsie #RowTheOats #RowTheBoat #RTB t.co/qQNmPwArv…

2016-11-18: ROW ROW ROW OATS OATS OATS #RTB t.co/B7py7PFHW…

2016-11-17: How could I forget to mention @adsteinmann? t.co/p3YYf3Gjt…

2016-11-17: Great having lunch w/ these two #MIBest reporters @amyonthetrail & @MichiganGonzo at …

2016-11-16: Wait. Where’s @BellsBrewery? t.co/zMKRt9khf…

2016-11-14: Yes!!!! t.co/IAceTIFyN…

2016-11-14: YES!!!!!

2016-11-14: So many free agents… please buy them and not our beloved @tigers

2016-11-14: I love learning the stories behind our beers at @BellsBrewery t.co/sXExifXw5…

2016-11-14: Yay! @SproutSocial now has Two Factor Authentication! I love when apps I use everyday prioritize …

2016-11-13: I thought the question would be asked about Barron being sleeping during the speech…

2016-11-13: BRONCO NATION #RTB!!!!! t.co/p8AjrB9l9…

2016-11-13: !!!!!! t.co/p8AjrB9l9…

2016-11-11: I don’t get this Snapchat filter on WMU’s campus… a revolver? A buzz saw? Did …

2016-11-11: t.co/wwf53HHeR…

2016-11-11: When Odysseus is about to go all BA & defend his honor in what can only be described as a …

2016-11-11: Drama. Marathon reading continues. The Cyclopes is dead. Ulysses talks to the wind. The crew finds …

2016-11-11: This passage must have really spoke to me as a student. Still does today. #AintNothingButTheDogInMe …

2016-11-11: There’s a lot of Rowing the Boat in this book. @Coach_Fleck come #RTB with the Ancients! …

2016-11-11: Join us in person 2452 Knauss. You can also watch the live stream: t.co/nHfmjQRsH… …

2016-11-11: Great to be back at @WesternMichU for a marathon reading of the Odyssey. Will @wmubusterbronco come …

2016-11-10: t.co/RpUq7SkOU…

2016-11-10: t.co/MWW1fuy6h…

2016-11-10: t.co/zKLWjsh74…

2016-11-09: What does it show? Ticket splitting is alive and well in Kalamazoo County.

2016-11-09: Interesting Kalamazoo County stat: Mary Balkema, one of the most notable local Trump supporters, …

2016-11-09: When Wolf calls it, I call it too. Goodnight all

2016-11-09: So we get to go into work a little late tomorrow, right?

2016-11-09: You voted. It mattered. Don’t forget it. Even if things didn’t work out. Vote next time. …

2016-11-09: To quote a CNN ad…. “This is life… this is real life” …

2016-11-09: Barron Trump shows why children should have bed times.

2016-11-09: This all is insane. What we thought we knew about national politics is down the flusher.

2016-11-09: Woah here it is. AP is calling it t.co/ULZ5obrTi…

2016-11-09: How much did they spend on that stage?

2016-11-08: What I wonder now about @freep prediction is if they have people at Wayne County clerk office seeing …

2016-11-08: t.co/4QC8mJoVM…

2016-11-08: America needs a safety tonight #RTB

2016-11-08: 😢 t.co/VdTd2AEPN…

2016-11-08: .@freep thoughts? Just 17% in… t.co/uZLAIQmD4…

2016-11-08: I remember in 2014 both state Dems and Reps scratching their heads at how FREEP could call race so …

2016-11-08: From the Yoop, too t.co/j7sfpPCf1…

2016-11-08: Waiting on results out of Kalamazoo County…..

2016-11-08: .@caitilino good news!!! t.co/Tduw5YtAq…

2016-11-08: Also stocking up the Fritz Klug Election HQ with supplies for a crazy night t.co/tra3Hma9m…

2016-11-08: Ticker splitter! t.co/lRz7LWWaZ…

2016-11-08: Huge delay for CNN GO on my Roku… switching over to Apple TV

2016-11-08: Voter 156 in Kalamazoo precinct 3 t.co/mNTmqUO8E…

2016-11-02: I don’t often tweet and have a beer, but tonight is an exception. Getting ready to chat …

2016-10-31: Why don’t they play this after a winning Tigers game? t.co/Y7TMfdr86…

2016-10-31: Woah “This Historic Church Building Is Seriously Being Destroyed by Urine” t.co/WdoYXr0FG…

2016-10-30: CC: @caitilino t.co/VYd55TPdq…

2016-10-30: Could you imagine if we got a free taco for every stolen base

2016-10-28: Love the #WMU flags @DowntownKazoo! #RowTheBoat @WMU_Football @Coach_Fleck #gROWh16her …

2016-10-27: The new touch panel on MacBook Pros looks awesome, but don’t really want to adopt until I can have …

2016-10-27: AND I…. WILL ALWAYS LOVE YOU!!!! t.co/bWfmCbtit…

2016-10-27: Going to be making some time to read this guide to social media marketing from @SproutSocial …

2016-10-26: Just as soon as these jerks started talking about a no hitter that happens.

2016-10-26: These national announcers always piss me off!

2016-10-26: Cubs are back

2016-10-26: Looks like something is going on at On the Rocks on Portage Street. Crime lab van and everything. …

2016-10-25: They’re playing the Imperial March for the Cubs?? Seems strange. Beat the Tribe!!

2016-10-25: It’s surreal to see that it’s actually Cubs vs Indians in the World Series. …

2016-10-24: So proud of @KalamazooCity & leadership from @Hope4Kzoo, Don Cooney, David Anderson, Jim …

2016-10-24: A great night in the history of Kalamazoo! So proud of my city, staff and elected leaders. …

2016-10-24: It passed! So happy for the new steps forming #KalamazooFuture. Kalamazoo continues to inspire!

2016-10-24: Amazing to hear @Hope4Kzoo talk about how Foundation for Excellence fits in with the history of …

2016-10-24: Updated live stream for #KalamazooFuture t.co/DveEZZiEc…

2016-10-24: Follow along live as Kalamazoo is on the verge of making history with the Foundation for Excellence …

2016-10-24: Wish I was there — one of my favorite @BellsBrewery beers and people to drink with! #DrinkinBoots …

2016-10-22: W

2016-10-19: I also don’t accept the results of the 2012 World Series. Rigged! t.co/wu3fcpPwX…

2016-10-19: Haven’t said this the entire election: this is something I strongly disagree with @JohnKasich …

2016-10-17: This Depressing Election t.co/bRZGoRdUa…

2016-10-17: Great to see @PBones highlight something us Michiganders have known for decades: @JohnDingell is a …

2016-10-16: No and no. It’s not too late for @ericmetaxas to #dumptrump t.co/3BLc3QqAI…

2016-10-15: Stealing home!!!

2016-10-15: Wait – I can have beer at a college football game? #RTB t.co/8eNNGivFe…

2016-10-14: Yes. It’s been making me few depressed lately that we’ve gotten to this point. …

2016-10-13: Nats really blew that lead. And scoring another run.

2016-10-13: Max is pitching an amazing game.

2016-10-12: Like finding a four lead clover in my lunch bag #DSDET t.co/uPtm47UqI…

2016-10-12: Mind blowing presentation from @brendan_mole today on some of the best experiential marketing …

2016-10-11: One of the most interesting things I’ve heard so far today. #DSDET t.co/EiOnMQ9oz…

2016-10-11: Although coffee is great to rejuvenate after a session, hearing “Invisible Touch” is 300x more …

2016-10-11: All that said, I should start using Google occasionally and native Twitter app to have an …

2016-10-11: As I realized I’ve missed out on SEO in my personal life bc I use @DuckDuckGo instead of Google, …

2016-10-11: In a panel on video on Twitter, so why not take a Twitter video? @CRumminger at #DSDET …

2016-10-11: Yup. “The internet has made it easy to be weird.” – Seth Godin at #dsdet …

2016-10-11: It’s hard to think about SEO and Google in my own life when I’ve been on @DuckDuckGo for years… …

2016-10-11: Insanely beautiful morning for #DSDET t.co/ct9wcFyqu… t.co/UIO2O8LLi…

2016-10-10: Just arrived in Detroit – can’t wait to attend @DigSumDetroit #dsdet …

2016-10-09: What’s with all the disposable cameras?

2016-10-09: Let’s canvas the streets @JohnBCurran…. or row t.co/NAyw6bmOf…

2016-10-09: IDEA FOR NEXT DEBATE: take Trump’s mic away after each question.

2016-10-09: I can’t believe this. The Republican nominee is a true national disgrace. I’m …

2016-10-09: This is unprecedented. t.co/yBKMVoMlA…

2016-10-09: Wow he’s going all out bully.

2016-10-09: .@realDonaldTrump, sometimes you just can’t apologize. If you really respect women and all …

2016-10-09: That was amazing. Bravo @HillaryClinton

2016-10-09: Does Trump agree Hillary should be President???

2016-10-09: NO HANDSHAKE!!!!

2016-10-09: Could this be one of the craziest and historic debates in American history?

2016-10-09: Hmmmmm did a Spotlight search for “Showtime Schedule” and the top result was a 2005 …

2016-10-07: Enjoy one for me, @BugsySailor t.co/mcQDCiqdx…

2016-10-05: Thelonious Monk Creates a List of Tips for Playing a Gig “Don’t Listen to Me, I Am Supposed to Be …

2016-10-04: Wow Pence just looked uneasy during Kaine’s listing of Trump’s most outrageous …

2016-10-04: Question of the night: why does @realDonaldTrump retweet the way he retweets?

2016-10-04: What else is on the docket that the candidates can’t debate? Let’s keep going with this.

2016-10-04: One thing I always realize during debates is how delayed the live stream can be. Really, I’m …

2016-10-04: Kaine is playing the Trump card

2016-10-04: This is what you could call a “comfort debate” t.co/fZ1Akde4N…

2016-10-04: It’s a mess. Do the organizers care about the VP debate? t.co/E6fGjt4LN…

2016-10-04: Oh this split camera looks awkward already. We need better camera position.

2016-10-04: Always my favorite debate.

2016-10-04: It’s a lot of hard work, but the results are palate bending. Awesome video featuring our brewers at …

2016-10-02: I think I see @AdamBitely somewhere… t.co/YsRMdZHZ0…

2016-10-02: Thank you @tigers for a great season. Although I’m sad tonight, I’ll have these memories …

2016-10-02: Last player on the bench… t.co/dpeEKqUux…

2016-10-02: 😭💔

2016-10-02: That Braves chant is more annoying than normal.

2016-10-02: If there were any three batters who could score a run and keep the Tigers in it, it’s the next …

2016-10-02: IGGY! (And Ramirez!)

2016-10-02: There goes the clutch no hitter

2016-10-02: Game time. #gotigers What a wicked day when I’m also rooting for BOTH the Red Sox and the …

2016-10-02: I would normally hope a win for any home team on such a historic day… but not today #gotigers …

2016-10-02: The team is back together. If we can’t win with this perfect @tigers lineup, we don’t …

2016-10-02: Is @PAWSDetroit a cat of the cloth? t.co/tZTMHp62N…

2016-10-02: It must be getting harder and harder to find pro-Trump voices. t.co/aogYK9Bfz… …

2016-10-02: It’s the only explanation of what’s going on here. t.co/bcDTVzDrk…

2016-10-02: Jake Tapper just killed it

2016-10-01: +6 t.co/C3jiaBoog…

2016-10-01: It’s kinda sad hearing Braves fans singing “take me out..” at Turner field for one …

2016-10-01: #RowTheBoat!!!!!

2016-10-01: Sweet t.co/Z7opO94bM…

2016-10-01: Hey @wmubusterbronco just saw you on the TV

2016-10-01: This is the one day of the year where things could get nasty between friends… @MichiganGonzo …

2016-10-01: No ESPN 3? How are you all going to stream the #wmu and #cmu game today?

2016-09-30: Super important stuff to keep in mind: #SproutAllStar @SFErika outlines 6 key steps for creating a …

2016-09-29: nooooooooooooooooooooooooooooooooooooooooo But maybe now I can go on Monday? t.co/KJQI1niiK…

2016-09-29: Love my @BellsBrewery family! t.co/UOlGTlvCn…

2016-09-28: Thinking of my friends in Pittsburgh today t.co/ayHr2N6Vg…

2016-09-28: Downtown Kalamazoo has again gotten less livable, unfortunately. It’s hard to get basic items …

2016-09-28: Looking forward to attending @DigSumDetroit 2016 in a couple weeks! t.co/Nva85H2fv…

2016-09-27: Welcome back Nick! A double for all your trouble!

2016-09-27: He got his wish!!! t.co/8Wv4fRInD…

2016-09-27: Aren’t we all that kid at the @tigers yelling “Come on J UP!” @FOXSportsDet

2016-09-27: Miggy doesn’t get hurt… he hits home runs

2016-09-26: “America… help me. I’ve just spent 90 minutes with this man. He’s just as …

2016-09-26: Did Trump almost just say “Stop and Fritz?” 😬😬😬😬😬

2016-09-26: Did people just cheer during the debate?

2016-09-26: Has Trump even ever watched a presidential debate?

2016-09-26: Should have gone with Squarespace. t.co/FQ7AjQbWG…

2016-09-26: I hope Mr. Holt consulted some preschool teachers… actually those kids are probably better …

2016-09-26: The real Donald is cracking out of his shell

2016-09-26: Holy shit this is real

2016-09-26: Chills. Tears. This is amazing. #JDF16 t.co/whNZWXQ6i…

2016-09-26: Had an amazing time seeing @Metric last night in Detroit. Everything I imagined and more in their …

2016-09-24: Ready for an elite night of football in #Kalamazoo. Good luck @WMU_Football and @Coach_Fleck …

2016-09-17: Announcers said “This is classic @bigten football” right before @WMU_Football scored another …

2016-09-17: When is @ESPN going to start saying “@MACSports on ESPN” instead of @bigten? #gobroncos #rtb …

2016-09-17: Wow — BRONCOS!

2016-09-15: This inning….

2016-09-15: So excited to watch Larry sing during the 7th Inning Stretch tonight… only a Master Brewer can …

2016-09-13: A sign iOS 10 is on the horizon! t.co/HtZyn7RRW…

2016-09-10: What a cool event t.co/gLdzoG3RQ…

2016-09-07: Good overall view: Social media levels the playing field for businesses of all sizes. Advice from …

2016-09-06: Wish I was there! t.co/7Vf6vYn8Z…

2016-09-06: This is a really cool thing Bell’s does… I love seeing what everyone comes up with. …

2016-09-05: J⬆️!!!!

2016-09-05: Happy Labor Day! t.co/b833sBaMZ…

2016-09-03: Cheers Broncos to a great win against Northwestern! #RowTheBoat #RTB t.co/1WAC8W8EJ…

2016-09-03: Sounds like there are lots of Broncos there today

2016-09-03: BRONCOS!

2016-09-03: Ready to #RowTheBoat! Here’s to a great season @WMU_Football @Coach_Fleck @MyWMU …

2016-09-03: Can he come back? t.co/2Q7CkFeWC…

2016-09-03: This sucks t.co/xOBAZhsMm…

2016-09-03: Normally don’t like this stuff, but this is 👍: Bill Gates, Warren Buffett, and Oprah Winfrey …

2016-09-03: A great program Bell’s and several other breweries are participating in again @Pints4Prostates …

2016-09-01: But Dantonio has the momentum going now… t.co/2rgt0mWRi…

2016-08-31: .@nancykaffer I’d love to show you around Kalamazoo & what makes it such a unique place …

2016-08-30: I’m supporting the Kalamazoo City Commission & staff to explore how to make the …

2016-08-29: He brought several smiles and delight to my face… RIP t.co/xHxEtCW8R…

2016-08-28: Had a great vacation… now getting ready to get back to the grind tomorrow morning. …

2016-08-25: Absolutely one of my favorite apps. Scoop it up. Now. t.co/f8qw4tILk…

2016-08-24: Great to see some app friends on demo devices at @Apple on Fifth Ave. @OmniFocus @OmniGraffle …

2016-08-24: Stopped by @Apple in NYC today – cheers to 5 years as CEO @tim_cook! t.co/5qW30vIWW…

2016-08-24: Watching news about how @tim_cook is not innovating at Apple – do they know what they are even …

2016-08-23: Junpstarted my career t.co/I4WVKQXYa…

2016-08-23: Don’t know how I feel about this… Instapaper has been acquired by Pinterest …

2016-08-23: .@POTUS @BarackObama leaving the White House in Marine One to head to LA and tour flooding. …

2016-08-22: Thank you @SmugMug, thank you again. Your kindness is blowing my mind.

2016-08-22: It’s amazing to have something work so easily.

2016-08-22: After months and months of little to no communication, with false promises… @SmugMug saves my …

2016-08-22: This whole @picturelife fiasco has been a living hell. Thank you @SmugMug, thank you. …

2016-08-15: Some really good points tonight on FOE. Simply there is no proposal yet. Let’s wait, debate …

2016-08-15: Cooney adds he never met the donors – in fact they probably supported candidates who try to …

2016-08-15: Cooney: The idea there is a conspiracy… I totally reject. People have done the best they can. …

2016-08-15: Cooney: will not vote if money could be withdrawn or withheld in the future #KalamazooFuture

2016-08-15: Vice Mayor Cooney said he would never vote for a proposal that gives control of money to other …

2016-08-15: Urban on FOE: We have the chance to do it right – but we have to work more closely together …

2016-08-15: It would be concerning if a full proposal was presented to the commission to vote on. An idea was …

2016-08-15: I agree with @MattMilcarek’s call for open discussion on FOE, but isn’t it the job of city mgr …

2016-08-15: The Foundation for Excellence has the opportunity to do more to combat poverty than anything else in …

2016-08-15: Another complaint: you need to have these conversations out in the open. It’s going to happen. It …

2016-08-15: Wait… what’s the Center for Excellence? ;)

2016-08-15: Concerns arise that the process is not being done in the open. How is it not? This is still in the …

2016-08-15: We’ll have time for debate once the details are worked out and a proposal is presented. …

2016-08-15: First citizen comment on the Foundation for Excellence — wanting more facts. They’re coming… Citizen …

2016-08-15: Thank you @kzoogrowlers for another great season. @KzooPorter hope to see you at the #EccentricCafe …

2016-08-15: Missed my calling. I could be a junior ranger during the day and a junior brewery at @UpperHandBeer …

2016-08-15: woah… something’s looking pretty sweet on t.co/qccgAha2u…….

2016-08-14: I have never seen an interview where someone has gone after the media with little to no facts to …

2016-08-14: The only reason Trump is so mad at the media is because it’s probably one of the first times …

2016-08-13: .@Tigers and @BellsBrewery #TwoHearted. New cans. So many people have worked hard to make this …

2016-08-13: I love when @Tigers are away games & the home stadium plays “7 Nation Army” Don’t they know …

2016-08-13: Are they ever going to fire her? t.co/ha5A4oec0…

2016-08-10: When someone makes a @BellsBrewery #EccentricCafe meme and it blows up on Reddit… …

2016-08-09: Wait this is an away game? This crowd has some love for Miggy

2016-08-09: This game is better than anything I’ve seen yet in the Olympics. Go Max Go!

2016-08-06: I think @RodAllen12 just said I need to get a life…

2016-08-06: Boy these Jets baseball players are really injuring our Lions baseball players.

2016-08-06: These Lions baseball players are falling!

2016-08-06: Lions baseball is my favorite kind of baseball

2016-08-06: magnum cum laude – what’s that?

2016-08-06: According to @RodAllen12, @ComericaPark is special bc they have lions on their scoreboard #tigers …

2016-08-06: According to @RodAllen12, @ComericaPark is special bc they have lions on their scoreboard #tigers …

2016-08-06: WAIT – did Rod Allen just say there are Lions on top of the scoreboard???? #tigers …

2016-08-05: A fun video to make… which answers a question I’m sure we’ve all had… t.co/fqdTjVvTP…

2016-08-05: I have a case of this in the cellar… may have to crack one soon… t.co/3pHs9bL8E…

2016-08-04: A cat has to stay cool! t.co/jGTiWbVdM…

2016-08-03: O hi Ohio I barely spent time with you. t.co/kuZlFrAoY…

2016-08-02: not many close elections tonight in Kalamazoo County….

2016-08-02: If the Tigers get more runs then people who voted here I will be both very sad and very happy …

2016-08-02: Wow — Kalamazoo Pre. 4, which is mostly west of WMU’s campus, had 18 people vote today with 1.21% …

2016-08-02: After unwanted surprises, it’s time for a short break, watch election results, and enjoy the …

2016-08-02: Yup t.co/ad52zB8Cf…

2016-08-02: .@CottageInn? t.co/OfNOYFltJ…

2016-08-02: No longer a reporter watching results come in from clerks… I wonder, whats the best way to watch …

2016-08-02: It’s a big day @jakedurrett! t.co/jmg9eMMT3…

2016-08-02: Keep in mind. Makes #MI01 all the more interesting. t.co/55l5rE0Nv…

2016-08-02: Polls are closed… time for results. Democracy in Action.

2016-08-02: We need a comic book written like this… t.co/84zAoTJzz…

2016-08-02: Bigger question: do McCain or Ryan even really want Trump’s endorsement? t.co/xH7jkxzmM…

2016-08-01: Wow. How is Pence handling this campaign? I’m sure he’s not on board with the crowds. …

2016-08-01: .@Hope4Kzoo to commission on Foundation: I entrust you folks have this and protect the governance …

2016-08-01: On Foundation for Excellence, @Hope4Kzoo says: We’re doing the work you’re asking us to …

2016-08-01: Funding cuts tells citizens the government doesn’t value you. FOE makes a statement “we …

2016-08-01: I am not going to pick apart this opportunity to death. We have the opportunity to dream – …

2016-08-01: More great words from Comm. Anderson on Foundation for Excellence regarding cuts to cities. …

2016-08-01: Comm. Knott: I support this investment, thank the donors and looking forward to working on this …

2016-08-01: Great words of support from Comm. Knott on FOE: Let’s talking about actual opportunity and not …

2016-08-01: #KalamazooFuture t.co/LW1vGmMRM…

2016-08-01: Meeting starts at 7 pm at City Hall #KalamazooFuture

2016-08-01: Getting ready for tonight’s Kalamazoo Commission Meeting — each one is important as they consider …

2016-08-01: Thank you @WMUPrezDunn for everything — you were a great leader and inspiration when I was at #WMU! …

2016-08-01: This will be fun: iOS 10 Beta 4 Includes Dozens of New Emoji Promoting Gender Equality …

2016-07-31: Wow – Trump campaign manager blaming a response Trump gave because of question from …

2016-07-29: You caught me. I was wondering why @blessyouboys wasn’t coming up. This is the @BellsBrewery …

2016-07-29: Is it just me, or does Jimmy Leyland look a lot younger tonight? #tigers @blessyouboys

2016-07-29: The first thing my mom @deb_klug does when she comes back to Michigan from Ohio is stop by @meijer! …

2016-07-29: This is what @KalamazooCity #FoundationOfExcellence is all about. From @emilymonacelli: …

2016-07-29: #7: It’s historic — 6 things to know about $70 million donation to Kalamazoo …

2016-07-29: .@detroitnews: $70M from new Kalamazoo foundation a ‘game changer’ t.co/qIBwDr9wQ…

2016-07-29: .@wmuk1021: Donors Offer City Tens of Millions for Budget #FoundationOfExcellence …

2016-07-29: You haven’t been wearing them the whole search?!?!? @MichiganGonzo what’s going on???? …

2016-07-28: Let’s make history #FoundationOfExcellence t.co/MBGcGy1LW…

2016-07-28: Cooney summed it up best: we have the opportunity to turn dreams into reality …

2016-07-28: Unanimous support to pursue the #FoundationOfExcellence. Thank you commission. Now the work begins. …

2016-07-28: Wait aren’t the commissioners citizen representatives…

2016-07-28: Real good questions from @MattMilcarek now – addressing many of the concerns I have about …

2016-07-28: One thing I love about #Kalamazoo is that the philanthropists donate to make people’s lives …

2016-07-28: I have to say – I’m having a really hard time containing my excitement about the …

2016-07-28: Comm. Anderson asks very poignant question: we’ve dreamed a lot for a miracle like this …

2016-07-28: Lots of politicians have said they will reinvent how government works. Nothing touches this. Proud …

2016-07-28: Finally we get to clap for #FoundationOfExcellence t.co/7VdVvMTZL…

2016-07-28: Time to debate the #Kalamazoo #FoundationOfExcellence – I have so many questions but we would …

2016-07-28: This is a historic moment in #Kalamazoo – again our leaders are thinking outside the box and …

2016-07-28: I mean, when you think about it, this is bonkers. In the best way possible. #FoundationOfExcellence …

2016-07-28: This #FoundationOfExcellence is an amazing feat navigating the shrinking shared revenue, unlike …

2016-07-28: .@KalamazooCity finding a new source of funding to stop reliance on broken Michigan Municpal …

2016-07-28: Foundation of Excellence!!! t.co/nbVRsjFa5…

2016-07-28: Imagine if… Kalamazoo bringing it with new questions. t.co/HvFuM2oiM…

2016-07-28: I hope this isn’t a boring budget meeting… t.co/XpqD2yiGk…

2016-07-27: Getting ready for a night of baseball with the @BellsBrewery family – @KzooPorter will you be …

2016-07-27: I was only kidding. I know very well the boundary… I’d be drinking a Yooper right now …

2016-07-27: Doesn’t seem to find any in Kalamazoo, though, is this working @UpperHandBeer??? …

2016-07-27: Looking for @UpperHandBeer? We now have a brand finder t.co/IAMG2fWZF…

2016-07-27: Can’t wait to get a 12 pack if Octoberfest – one of my favorite @BellsBrewery beers …

2016-07-27: If you’re looking for a good lunch downtown #kalamazoo… this is it. t.co/EKYQAdcHp…

2016-07-27: This election gets more and more wild: Donald Trump Challenges Russia to Find Hillary Clinton’s …

2016-07-26: Com’on – most people weren’t typinglwtters in a computer during Clinton’s …

2016-07-26: It’s silent now. Wow this is moving

2016-07-26: Doesn’t sound like people are listening to the speakers at the Dem convention… maybe it’s just the …

2016-07-25: Interesting. Many establishment Republicans use this same logic to support Trump. …

2016-07-25: What a night. Catching up on the convention. Looks like it was a hell of a night.

2016-07-25: Nice profile from @detroitnews on @BellsBrewery at #MiSBF16 t.co/sfvJnwAoZ…

2016-07-24: These Tigers!!

2016-07-24: Good luck Cubbies… Joe Nathan joining Cubs’ bullpen t.co/Hwaa20Jmk…

2016-07-23: It looks like clipboard sync is working on iOS Public Beta 2 with OS X El Capitan

2016-07-22: Stop what you’re doing right now and make sure two factor authentication is turned on for all …

2016-07-21: Terrifying stuff on TV.

2016-07-21: Thank you t.co/L1UH9OXJd…

2016-07-21: This is exhausting – but you can’t get tired because then you don’t fight back.

2016-07-21: How can you restore safety in one day?

2016-07-21: Here Comes The Sun… I wonder who owns the rights to that and if the Beatles are ok with …

2016-07-21: Wait – didn’t Rudy say during his speech he wouldn’t tell the story about …

2016-07-21: Wow. This is real. Trump is the nominee.

2016-07-21: It’s an infomercial!!!!

2016-07-20: The latest…….. t.co/7kJXDQCBs…

2016-07-19: Maybe it’s American Muslim for Trump. t.co/TULvB1c1K…

2016-07-19: No. One. Is. Clapping.

2016-07-19: Dang, that look on @secupp’s face re: Carson’s Lucifer comment. #RNCinCLE

2016-07-19: It’s not often you hear the subjunctive in English… t.co/jBm9wDYEy…

2016-07-19: Don’t let @realDonaldTrump win Ohio, @JohnKasich — you did it once, please do it again.

2016-07-19: There’s nothing about a mess in that Latin…

2016-07-19: “Status Quo” is Latin for the “mess we’re in”… really? #RNCinCLE

2016-07-19: I’ve never heard so many Christians have to say over and over again that they are Christians …

2016-07-18: This was night 1 – what will tomorrow bring?? t.co/rrtAGMOoe…

2016-07-18: I hope my wife never calls me with my middle initial.

2016-07-18: Daft Punk is playing at my house. t.co/B5pe5AjcL…

2016-07-18: That was crazy t.co/UGWFrXxxv…

2016-07-18: I wonder what Queen thinks of this…

2016-07-18: Will this thing be done by 11?

2016-07-18: Is Giuliani channeling his inner Trump?

2016-07-18: CNN is killing it with the facts t.co/CheqpKKkB…

2016-07-18: I’m wasted t.co/ke68IQiVU…

2016-07-18: I need to eat dinner: RICK PERRY didn’t mention Trump in his speech.

2016-07-18: Good caption CNN — could be used for the whole convention t.co/5YMwI0kue…

2016-07-18: Fascinating read: For journalists covering Trump, a Murrow moment t.co/NhsK16AQi…

2016-07-18: A lot of stuff I didn’t realize in here: 22 Overlooked iOS 10 Features You Should Try Out Now …

2016-07-18: This is beautiful: 1,600-Year-Old Illuminated Manuscript of the Aeneid Digitized & Put …

2016-07-18: Woken up by the craziest of storms. Downpour – winds – thunder – lightning!!!

2016-07-17: There is none t.co/PtUT1kPE6…

2016-07-17: Woah what just happened on CNN

2016-07-17: It really does feel like Trump and Pence don’t know where the other stands on issues. Feeling each …

2016-07-17: This is awkward! Trump is giving Pence permission to speak his mind.

2016-07-17: I’ve missed watching 60 minutes

2016-07-17: Happy Tigers!!!!

2016-07-17: This is in Kalamazoo, BTW t.co/aqboEH9Mp…

2016-07-17: This is not the answer. Horrible. Confused about what to do to help make these horrible acts stop.

2016-07-16: Lesson from today’s announcement: Trump doesn’t like to share the limelight. It showed. …

2016-07-16: I hope all the photojournalists there were able to get that photo…

2016-07-16: Hmmmmm not the best. I wonder if any artists will let him use their music. I think Romney used up …

2016-07-16: How much stage time did Trump and Pence actually have? Less than a minute.

2016-07-16: Totally. Not a press conference. t.co/Pxghrj2wX…

2016-07-16: What a strange end to the press conference.

2016-07-15: What is going on #swce? Reel for the third time? Holding back for online release I bet…

2016-07-15: Come on Rouge One Trailer! #SWCE or Episode 8!

2016-07-15: Watching this Rouge One feature — oh my it’s beautiful. And a snub against green screens!

2016-07-13: Going to have to give this app another try – killed my battery life before. “Recapture …

2016-07-12: Hey @gruber — don’t know if you’ve seen what’s happened with @picturelife — site’s down and we don’t …

2016-07-12: All I think during the #ASG Please, don’t let @MiguelCabrera get hurt Please, don’t let …

2016-07-12: What impact will Pokemon Go have on the RNC convention?

2016-07-12: I think there are going to be many discussions like this as we head into 2017: The Reformation, a …

2016-07-12: With the #ASG today, no better time to announce I’m joining the @SproutSocial #SproutAllStars …

2016-07-12: I have the ACME poster… now every item on board Apollo 11? Sign me up, @FringeFocus: …

2016-07-12: I’m going to have a lot of fun with these Amazon Dash Buttons… see a lot of hacks with …

2016-07-12: I’m not much of a Disney fan, but this massive LEGO set looks amazing… …

2016-07-12: I may have to pause catching them all until this is fixed: Pokémon Go raises security concerns among …

2016-07-12: oooooh you’re my best friend in a world we must ferment! t.co/Nb6VhGzhi…

2016-07-12: .@UpperHandBeer for sure!!! t.co/LrQsvkAiY…

2016-07-12: What a great idea for a search @MichiganGonzo & @amyonthetrail! Help us find …

2016-07-12: A loss for our community… @Kzoo_Gazette obituary on @stjulianwinery’s David Braganini …

2016-07-12: I’ve been holding off on getting LED light bulbs for a while… today’s the day t.co/7RCjH1cvx…

2016-07-11: 💔 t.co/NB1RwOvRA…

2016-07-11: Praying everyone will be OK… t.co/Xk5DlihqS…

2016-07-11: The community has dealt with so much in the past decades… praying it’s nothing serious. …

2016-07-11: Fuck t.co/jWqRZQFxF…

2016-07-11: Subscribed: A New Podcast, Bookworm t.co/soBW7LzB8…

2016-07-11: I just bought 17 Amazon Dash buttons… this is going to be interesting… …

2016-07-11: Hopportunity Cost: Craft Brewers Brawl Over Catchy Names as Puns Run Dry t.co/LMnJ3zEHM…

2016-07-11: A truly beautiful celebration of the Great Lakes: Boats ready for 92th annual @BYCMack …

2016-07-11: My favorite picture of beer I’ve ever taken. t.co/YumAeNs8O…

2016-07-11: Please, don’t use it for green beer: 100-year-old Michigan ‘Spartan’ barley being revived by …

2016-07-11: Nice shout-out to @KalPublicSafety in @USATODAY on how the dept continues to work improving …

2016-07-10: This is all good to hear t.co/OelTagN6l…

2016-07-09: I’ll be live streaming the competition on my Facebook page: t.co/THl3YyO2j…

2016-07-09: In Grand Rapids today for my first Coney Dog eating competition. Been training for a bit. Proud to …

2016-07-08: 🎉🎂🎉🎂🎉🎂🎉🎂🎉 🎂🎉🎂🎉🎂🎉🎂🎉🎂 🎉🎂🎉🎂🎉🎂🎉🎂🎉 🎂🎉🎂🎉🎂🎉🎂🎉🎂 🎉🎂🎉🎂🎉🎂🎉🎂🎉 🎂🎉🎂🎉🎂🎉🎂🎉🎂 🎉🎂🎉🎂🎉🎂🎉🎂🎉 🎂🎉🎂🎉🎂🎉🎂🎉🎂 🎉🎂🎉🎂🎉🎂🎉🎂🎉 …

2016-07-08: If you don’t #VoteKinsler #VoteMarte — he will find you t.co/7eY7mbWEb…

2016-07-08: You ask: #VoteKinsler? #VoteMarte? This @tigers bobble says yes and yes! t.co/8D6LEE5zf…

2016-07-08: Do your duty @tigers fans! #VoteKinsler

2016-07-07: We don’t know the solutions to our problems but it’s pretty clear this isn’t it. …

2016-07-07: Going to have to spending a lot of time reflecting on this. It’s hard to wrap your head around …

2016-07-07: But who knows. All too soon. Too many thoughts and emotions.

2016-07-07: Never thought they would. Nothing in the photo would initially shock me. But does now. Should we …

2016-07-07: I covered so many rallies where people carried rifles like in the photos of the suspect. They never …

2016-07-07: Two days of terrible news. Alton Sterling. Philando Castile. 3 more. Violence can never solve these …

2016-07-07: What can we do to make the violence stop? Aren’t we seeing the signs as these acts happen one …

2016-07-07: Dear Lord what is happening in this world?

2016-07-07: Final thoughts on first bit with iOS 10 beta… this will be the title of my first hip hop …

2016-07-07: Strange stuff t.co/jHVXqdk6P…

2016-07-07: t.co/jUL5gdzlD…

2016-07-07: Third order of business t.co/Tur3qW0Tk…

2016-07-07: Second order of business t.co/eRKQu7JgE…

2016-07-07: First order of business t.co/Y0H5cz5g1…

2016-07-07: Just installed the iOS 10 beta. Almost got hit with a foul ball playing with it

2016-07-07: Had a blast checking out Wrigley yesterday with @AdamBitely on the @BellsBrewery bus trip. Best …

2016-07-07: Anyone giving a tour would like to answer these… 5 Questions Brewers Wish You Would Ask …

2016-07-07: Almost as exciting as a new Star Wars movie….! t.co/lZicXbuzE…

2016-07-07: Hey @KzooPorter — going to the @kzoogrowlers game tonight?

2016-07-06: This will be an amazing election to watch… The first true trolling matchup? …

2016-07-06: Look who’s back talking trash… @deb_klug #gotigers t.co/pumvqRJ0s…

2016-07-06: LIVE on #Periscope: National Anthem at Cubs vs Cardinals game t.co/050aPhFwD…

2016-07-04: I miss Rajai

2016-07-04: No joke, the announcer said “Ass-mus” t.co/qSHgM213S…

2016-07-04: LIVE on #Periscope: Detroit Tigers and Cleveland Indians – Star Spangled Banner on 4th of July …

2016-07-04: Hardest job in Cleveland right now. t.co/PR0yIAM1V…

2016-07-04: And…. t.co/DfSrluswa…

2016-07-04: Wow – tough job @BetsyKling has telling the crowd there is more rain coming during @tigers/ …

2016-07-04: I think the Cleveland Indians must be afraid of the rain #GoTigersGo

2016-07-04: Rain delay… You know what the means… Training @MichiganGonzo t.co/Tb34B5eti…

2016-07-04: Rain delay? But the sun is shinning! #oberon @BellsBrewery @tigers t.co/78wETNesc…

2016-07-04: Honk if you like the Detroit @Tigers! Representing the D in CLE! ⚾️ t.co/1ZV9FPGgv…

2016-07-04: MEDIA BLACKOUT – a TV station won’t talk to Tigers fans in line for the game! …

2016-07-04: Not even in the park yet and @deb_klug is talking trash to a TV crew #gotigers

2016-07-04: Cleveland is certainly excited… Gates don’t open for 5 minutes and the line goes to 9th …

2016-07-03: Way below the bridge…. - Drinking a Double Ringer by @Upperhandbeer @ Village of Walton Hills …

2016-07-03: The FT’s summer books 2016 – I absolutely love these book lists t.co/nvAoH7LJF…

2016-07-03: My favorite Kinsler moment — the binoculars… t.co/1x273iuuR…

2016-07-03: Congrats Ian Kinsler on HR 200!!!!

2016-07-03: Party in Tampa Bay

2016-07-03: So the Tigers have a home field crowd in Tampa Bay?

2016-07-03: I’m going to have to try this… Stroh’s To Be Brewed In Detroit Again - And …

2016-07-03: YUP! t.co/m6FRYW42U…

2016-06-29: This is crazy: 9 Tigers games for $49. Is this a way to get fans in seats for a team teetering …

2016-06-28: I’d follow that road… but may not remember the way back. t.co/Pfh00Eexe…

2016-06-28: Looking forward to a week of baseball next week: @tigers vs. @Indians on Monday, @Cubs on Wed and …

2016-06-28: ✔️🍻🌞🔔🔔🔔 t.co/p72GMCcfi…

2016-06-26: Should have skipped watching the @Tigers and gone to the @kzoogrowlers game today

2016-06-26: WHAT IS GOING ON DETROIT TIGERS

2016-06-24: And I think I have some inside info on what @MichiganGonzo may choose for the next #MIBest …

2016-06-24: Had a great lunch with my #MIBest friends @MichiganGonzo and @amyonthetrail. How do they use their …

2016-06-24: That’s my super excited and hungry face! #mibest t.co/9T6wK6Mx6…

2016-06-24: I’m getting hungry… what’s for lunch @MichiganGonzo, @amyonthetrail? #mibest

2016-06-24: No toss ups? That says a lot t.co/qs8zD02cB…

2016-06-24: Yup: “If you can’t trust your camera, you can’t trust your keyboard either.” – …

2016-06-23: Now this is actually terrifying: Fall Out Boy and Missy Elliot cover Ghostbusters themes song …

2016-06-23: Scary Teen stuck inside giant Barney dinosaur head is freed by firefighters t.co/yFXKHLC23…

2016-06-22: My defense of the #MIFlag re: @RickDeVos’ suggestion that we should change it because it’s “ugly” …

2016-06-22: Tuebor: Defending our Michigan Flag The Michigan flag has flown over our Capitol and across our two peninsulas for more than 100 years: …

2016-06-21: $62.91 from Amazon because of Apple eBook lawsuit! What should I be reading?

2016-06-21: But so popular it was sold out at @Meijer yesterday… Need to try it soon to see what’s …

2016-06-21: Collecting water bottles is a guilty pleasure of mine t.co/8J9sqAvgE…

2016-06-21: Spot-on analysis of the two recent O.J. Simpson miniseries t.co/EkUoJlqV9…

2016-06-20: I think #WhyTheyHateUs really missed the mark when taking about violence in the Bible w/o …

2016-06-20: And I just poured a fresh drink

2016-06-20: UPTON BABY!!!

2016-06-20: And @KzooPorter is growing on me… t.co/rGqAMZRTw… t.co/0pXfaT16o…

2016-06-20: Had a great time tonight catching the @kzoogrowlers play on the longest day of the year …

2016-06-20: An extra inning @tigers game is only suitable for #SummerSolstice #gotigers

2016-06-20: The announcer just called @KzooPorter is the best mascot in Kzoo. I love ya brother, but I gotta say …

2016-06-20: What a cool experiment t.co/Bv55SDay2…

2016-06-20: I’ve always loved Path, too, but unfortunately no one I know is really on it… …

2016-06-20: This Indiana Jones face-melting candle may be the best thing ever… t.co/wFIkRlOEp…

2016-06-19: Thanks for visiting, @InsideBrewCity – looks like you did your visit right! …

2016-06-17: So proud of everyone I work with at @BellsBrewery – #TwoHearted is #2 – #Hopslam is #8! …

2016-06-16: Maybe I should start doing this… Manners maketh Nan: Google praises 86-year-old for polite …

2016-06-16: 👍👍👍👍👍👍 Props to @RepFredUpton t.co/RXjWpHxTt…

2016-06-14: Beautiful t.co/f7eU5xsgV…

2016-06-14: It’s more important than ever to celebrate diversity. t.co/5ZpTO0Btn…

2016-06-14: In a crazy world, this is a bright spot. t.co/J6TLevmKY…

2016-06-14: Ugh. The horrible news continues. t.co/B6GS7LmL9…

2016-06-12: #bonnaroo solidarity with Florida @bonnaroo #prayfororlando t.co/8N5SgIpOj…

2016-06-07: So heartbroken for #Kalamazoo tonight.

2016-06-06: Here’s how I schedule photos on Instagram using @WorkflowHQ and @dueapp @WF_Gallery …

2016-06-06: Huge fire in Comstock t.co/7zaOE7G4G…

2016-06-03: Never a boxing fan, but Ali made me care. He was confident, disciplined and had a sense of humor. …

2016-06-03: Ali

2016-06-02: #KalamazooStrong t.co/5i8UTNUok…

2016-06-02: And it’s just not #Oarsman…. t.co/ULpfkn21h…

2016-06-02: How I schedule @Instagram posts using @WorkflowHQ, @dueapp and @Dropbox t.co/5CDmRrwM0… …

2016-06-01: Schedule Instagram posts with Workflow, Due and Dropbox Instagram is probably my favorite social network, for both personal and work. I’ve tried a few …

2016-06-01: No joke. My beer. t.co/Q5Yun4VNh…

2016-06-01: Sometimes when you’re rendering video and need to go to a meeting… you do this. @ulyssesapp is so …

2016-05-31: What should I know, @mcmilzz? t.co/WRfmrkRVx…

2016-05-29: What kind of dugouts do they have in Oakland?

2016-05-27: Looks familiar @deb_klug? t.co/Ix1uGTTrL…

2016-05-26: Already walking down memory lane. This is amazing. t.co/QhBB0xlmb…

2016-05-24: Dave Chappelle asks questions, we provide answers. t.co/3B1pUctLC…

2016-05-23: Used #ExpressSOS for the 1st time. Took 1 min to renew tabs. Saved 2 hours. Now to enjoy the …

2016-05-23: A Northern Michigan gem! You never know what you’re going to find! (One time I found …

2016-05-17: Wow, looks like Dave Chappelle sold out instantly.

2016-05-14: Excited to see the world premier of a new concerto by Michel Legrand at @GilmoreFestival …

2016-05-13: And the bullpen is our problem? t.co/kBm4lezRQ…

2016-05-13: I’m sorry. A loss is a loss. There’s no “moral” losses now for the Tigers. …

2016-05-11: We all do t.co/Da1jNb5q8…

2016-05-11: I miss Max

2016-05-11: This is so hard to be rooting against Max. ANY OTHER TEAM!!!

2016-05-11: So allergies are beginning.

2016-05-11: So excited about this game #GoTigers t.co/3X68Tnruu…

2016-05-11: This may be my new favorite GIF of all time t.co/srX7CEOUA…

2016-05-11: .@SmithBrianA you know it 🤖

2016-05-10: This is huge: I can automate @LaunchCenterPro to launch my @OmniFocus grocery list when I get to …

2016-05-09: THE BULLPEN

2016-05-09: Radio broadcaster on TV? My grandpa would have loved this.

2016-05-09: mind warp #tigers game

2016-05-09: So great to have this at home - Drinking a Kalamazoo Hopsoulution Ale by @BellsBrewery - …

2016-05-09: Great article from @jamesshelley – need to spend more time at @KzooLibrary 4 Reasons to Love …

2016-05-08: Getting ready for a great drive home t.co/mbzI02kpe…

2016-05-08: I really can’t justify purchasing this but really really want one t.co/XnyCZqgqG… …

2016-05-07: This is amazing! Cheers to the amazing brewers … (Expedition Stout (Bourbon Barrel Aged)) …

2016-05-07: This is an argument my grandpa would have made Inhuman Baseball t.co/4am6tprKC… …

2016-05-07: Two of my favorite things. t.co/Q1d7V0QkR…

2016-05-07: I’ve seen so much support for Trump in rural Cleveland.

2016-05-07: One year later, I’m finally clearing out the @TextExpander snippets from my old job…

2016-05-05: Whew, kind of t.co/PQJ7OgU0f…

2016-05-04: The real kicker is @picturelife charged me today. For a down service… wow. I’m speechless. …

2016-05-04: .@picturelife, a service I’ve trusted for years, is fading away. It’s unclear if we’ll get our data. …

2016-05-04: Picturelife, trust and having data out of your control UPDATE: Just after publishing, checked my bank account and saw that I’ve been charged the …

2016-05-03: It’s come to this. The sad thing: will people even care if it’s a total lie? …

2016-05-03: That rally drum is giving me a headache

2016-05-02: Such interesting words auto-correct tries for “regram”

2016-05-01: Idea: The term “Beer City” can be used by any city that has beer t.co/MAH7wVKEn…

2016-05-01: Peak-a-boo PT. 2 with @MiguelCabrera #tigers t.co/15isc0QKG…

2016-05-01: .@MiguelCabrera plays peak-a-boo with @FOXSportsDet during Victor Martinez interview… Love this team …

2016-05-01: I love this team. #tigers Watch Miguel Cabrera videobomb Victor Martinez during postgame interview …

2016-05-01: It’s really good, too. I’ve made some pretty important decisions drinking this stuff …

2016-05-01: This was one of the coolest things I’ve done so far at @BellsBrewery t.co/9iXSAtfJF…

2016-04-30: I wish @cspan was taking calls. Want to hear the twitter of the older generation. …

2016-04-30: This has been a crazy night. Amazing

2016-04-30: Can you imagine what it’s like to be working at CNN right now?

2016-04-30: What a week of 🖕🏻 t.co/MLE2e5Rwv…

2016-04-30: And the GIF of @donlemon flicking off @larrywilmore on live tv. #WHCD t.co/hwi9QM7ps…

2016-04-30: With the hard questions t.co/SyXdDx3to…

2016-04-29: I work with some pretty amazing people t.co/rwrm6TpEs…

2016-04-25: Why did this just come to me now? Is this a true life Eastbound and Down? “You’re …

2016-04-25: What if we all went to work tomorrow and flipped the bird like Collins did…

2016-04-25: And, of course, I meant “of course” in my previous tweet

2016-04-25: And of corse we need a gif of Collins flipping the bird #tigers t.co/74MVuaylX…

2016-04-25: The play was bad, but probably not good to flick off @tigers fans at Comerica t.co/KFpV72ocB…

2016-04-25: Woah now Jim Price

2016-04-23: Awesome! What a great program! t.co/Gzfdi5xiN…

2016-04-23: Just saw the strangest thing near the Kalamazoo Airport tonight… t.co/J69uFo0u1…

2016-04-21: Oh lord heartbroken to hear about the loss of the great Prince.

2016-04-21: Craft Brewers Won’t Play By Germany’s 500-Year-Old Rules via @Bloomberg …

2016-04-17: The sun is back downtown Kalamazoo. t.co/o7Q5f3UDf…

2016-04-17: I remeber seeing this in grade and middle school. David Bowie Urges Kids to READ in a 1987 Poster …

2016-04-17: Just tried this… let’s see if it makes Facebook more managable… t.co/WDb27dJeg…

2016-04-16: Beautiful day for some Spring @WMU_Football #RowTheBoat t.co/XbMS7NuUT…

2016-04-16: It’s a good thing video of this didn’t come out t.co/B0k5WxNog…

2016-04-14: Is this why people don’t understand when I use Emoji? That Emoji Does Not Mean What You Think …

2016-04-13: We’re nominated for 3 #kzoosmweek awards. Take a look and consider voting for Bell’s - I …

2016-04-12: Is this any good @tinynotebook? Popular Pittsburgh eatery Primanti Bros. opening first two Mich …

2016-04-12: Are they going to do this for every game? #gotigers t.co/H3DzAfhIY…

2016-04-12: Can’t begin to tell you how much I love this Tweet. #bellsbrewery t.co/8kszq6vJx…

2016-04-12: Special Editions, but good thing they serve beer. I’ll need it for this: …

2016-04-12: Please hope this is a troll: New Indiana Jones story to pick up where “Kingdom of the Crystal …

2016-04-11: All the Cubs needed was a little home “Take Me Out to the Ballgame” to start scoring runs.

2016-04-11: By those hits, the Cubbies are happy to be home.

2016-04-10: If you didn’t know, you’d think the Cubs were at home by the crowd.

2016-04-09: Please don’t say he’s a second-ballot Trump delegate! t.co/STPm99d0l…

2016-04-07: Amazing. t.co/Juf26Ao8w…

2016-04-06: OK Comerica, I’ve been mad that you haven’t adopted Apple Pay, but this makes up for it, especially …

2016-04-06: Such a great strategy: hit home runs so you can jog the bases and not further injure yourself.

2016-04-06: Just washed my @tigers cap to be ready for Friday’s Opening Day game. Thankfully the radiator …

2016-04-06: Bases are loaded… And here comes Sanchez!

2016-04-05: What a game. I feel like our season will be very much like it

2016-04-05: VICTOR!!!!

2016-04-05: Can we get Nathan to come in to close later?

2016-04-05: Go nuts go nuts go nuts go nuts @LansingLugnuts @LansingLugnuts @LansingLugnuts @LansingLugnuts …

2016-04-05: I’m gonna say it: we had more than one candidate from our community who was more than …

2016-04-05: This is so fucking exciting.

2016-04-05: I never thought I would say this: Upton is doing good things for the Tigers

2016-04-05: So happy Detroit @tigers baseball is back.

2016-04-05: Thanks @TextExpander — don’t see it on the pricing page: t.co/NpMse5eN8… May help soften the …

2016-04-05: Bought @TextExpander 8mnths ago for $20 — now it’s $47 per year? @SmileSoftware I love the app, but …

2016-04-05: BASEBALL HOTDOGS APPLE PIE & CHEVROLET t.co/ucJpvytIb…

2016-04-05: I’m so excited! #GoTigers #Roar t.co/b9eWC83ZB…

2016-04-05: Such exciting news!!! t.co/R0pjMsnJw…

2016-04-05: The latest @BrewersAssoc ranking of craft breweries is out… t.co/k1KlJBPRK…

2016-04-05: Isn’t it pretty? It taste pretty good too. Can’t wait for more people to try @BellsBrewery’s …

2016-04-03: But the @Tigers don’t play until Tuesday… Will wear my cap tomorrow anyway. …

2016-04-03: Rewatching Freaks and Geeks for the first time since it aired. It all makes so much more sense.

2016-04-02: Hang in there @ Bell’s Eccentric Cafe t.co/3qNGlv5np…

2016-03-28: Been chomping at the bit to try this one. And it’s absolutely outstandi… (Oatsmobile …

2016-03-27: Χριστὸς ἀνέστη!

2016-03-24: So the new AT&T commercial is on – and the “Hey Siri” section set my phone …

2016-03-24: Excited to be back on @wmunews campus to talk about how studying Latin and Greek prepared me for …

2016-03-21: What a day. What a beer. - Drinking an Oberon Ale by @BellsBrewery at @bellsbrewery — …

2016-03-21: Happy #oberon day! @ Bell’s Eccentric Cafe t.co/LjOVP4Wwy…

2016-03-20: .@MichiganGonzo and I are getting ready for a midnight Oberon release with one of these… …

2016-03-19: It’s amazing. I’ve had a prototype. t.co/nnb5cfaTg…

2016-03-17: Ah. I forgot how much I love getting notifications like this t.co/k4NEr2Hre…

2016-03-15: Come on Ohio!

2016-03-14: Camera bag is packed. @ Bell’s Brewery t.co/DHEWFaIxZ…

2016-03-13: What is going on here? t.co/YtQ4jKOg7…

2016-03-13: Why do I always end up shopping on Sundays?

2016-03-11: Woah. Rubio is calling in to CNN?

2016-03-08: The best news of the night #kzoostrong t.co/jYpkO1dxz…

2016-03-08: We call it the Upper Hand t.co/i7kkRo6vZ…

2016-03-08: Trump is frustrating. Sadly, it seems things will get easier if we just accept him and move on. We …

2016-03-08: Trump is equating his ego with the strength of the country. This is scary stuff.

2016-03-08: nuts

2016-03-08: They had really good reasons to hold off t.co/qolwFcexk…

2016-03-08: The first thing I agree with Ye on. IKEA is the happiest place on earth t.co/5JmdB5zSU…

2016-03-08: Yup, John King, we may be waiting a looooong time waiting for Wayne County votes to come in. …

2016-03-08: Woah this is crazy. Great to see so many people voting t.co/CmUun9qtQ…

2016-03-08: Mad props to CNN for saying that polls in Michigan don’t close ‘til 9pm. Respect for the …

2016-03-08: Make sure to check your polling place location — surprised to see multiple precincts in the same …

2016-03-08: I think turnout is going to be high today for #MIPrimary. First spring day. Voter #66 at 8:30 am, …

2016-03-07: As a former political reporter this feels strange to tweet, but I’m so excited to vote for …

2016-03-07: Almost got rear ended by a red pick up truck zooming down Kings Hwy. running from @KalPublicSafety. …

2016-03-06: Never thought I would be hearing about the auto bailout again

2016-03-06: He’s back! Please come back to Detroit! t.co/BgbKYy9Df…

2016-03-05: Comes at a time when 2,166 people have been killed in the United States by gun violence so far in …

2016-03-05: Always an awkward moment as a reporter. Especially when candidates call you out. …

2016-03-05: I’m in a bizarre world of watching House of Cards and following #SuperSaturday on Twitter.

2016-03-05: In purchasing Opening Day tickets for the @tigers, I’ve called my friends “buddy” …

2016-03-04: WTF @netflix t.co/Kg7cCbbq2…

2016-03-02: Malfunctioning earpieces? I can believe how ridiculous and horrible the cycle has gotten. …

2016-03-02: Looks like a cool app: t.co/XQ3lng9I2… But confusing with this app, which has been around for …

2016-03-01: Someone needs to write a monologue about what’s going on in Christie’s mind right now.

2016-03-01: #MakeDonaldDrumpfAgain t.co/27pTX1sBy…

2016-03-01: I hope @Kyle_Feldscher is proud of the image editing in my last tweet

2016-03-01: “Why did I sell my soul?” t.co/bLTw7yMb3…

2016-03-01: WTF Christie? You were saying the same stuff about Snyder last year. #RideThoseCoatTails

2016-03-01: This. Is. Crazy. t.co/5yZlBX6jr…

2016-03-01: I wonder what a self driving car would do now? Would it ban the people who drive crazy fast I in …

2016-03-01: The roads aren’t super bad yet, only when big trucks pass and kick up snow …

2016-03-01: Where’s the lake? Downtown Lake City t.co/Z9Nq7Ey1s…

2016-03-01: LIVE on #Periscope: Horrible snow and roads south of Gaylord on M55 (I’m not driving) …

2016-02-28: This winning song really shows how out of touch the Academy is

2016-02-28: Wait, they rejected Radiohead for this?

2016-02-28: Wow, Chris Rock. This is amazing

2016-02-28: Trying to watch @netflix in my hotel — won’t load because I’m using @getcloak to secure my …

2016-02-22: We cannot be fearful but must instead unite & show the love and compassion that defines us …

2016-02-22: #KzooStrong t.co/MvzGSVtco…

2016-02-21: What is happening in Kalamazoo? I saw an ambulance followed by a cop car speeding down South abt 15 …

2016-02-21: When it hits home: t.co/KVaIezkNv… #KalamazooShooting #KzooStrong

2016-02-21: When it hits home It’s hard to admit, but I’ve slowly become numb to all the mass shootings. I’ve tried to avoid this, …

2016-02-21: #KzooStrong t.co/0wkfhi418…

2016-02-21: This… Wow t.co/wf6kDBSAB…

2016-02-21: Fuck fuck fuck t.co/th9hql3iG…

2016-02-21: Fuck fuck t.co/1TTxdtrpu…

2016-02-20: Fuck t.co/e5i2OFQl8…

2016-02-17: So they traveled to wine bars in all 50 states? Oh no, most highly rated. Not truly the “best” …

2016-02-15: 🐴🍻

2016-02-15: This beer is amazing. Can’t wait for it to be out t.co/tAiL0JxkZ…

2016-02-15: This is unfathomable t.co/e1R7yyZdF…

2016-02-13: woah

2016-02-10: It’s been 20 minutes and I’m still stuck waiting for this train to pass. The long long …

2016-02-08: Most of Gull Road is without power.

2016-02-07: BRONCOS WIN #RTB

2016-02-07: A great case against the algorithmic feed t.co/5rETHz03Z…

2016-02-07: On that note I’m opening a 30th Anniversary Ale

2016-02-07: So I thought that FitBit ad was for Apple Watch

2016-02-07: Ok NFL — you guys can call it the Super Bowl, the rest of us can only say “the big game” — let us …

2016-02-07: The craziest part of the Pokemon ad was that it was a father introducing his son to the game.

2016-02-07: POKEMON!!!!

2016-02-07: And Amazon just won the night.

2016-02-07: And Coldplay is just standing there…

2016-02-07: I kinda feel bad for Coldplay now. The crowd got loud for Uptown Funk. Like double

2016-02-07: My mom: hold on, @Beyonce is about to come on and it’s about to get a lot better

2016-02-07: I have a strange place in my heart for Coldplay, it’s near the spot for U2

2016-02-07: What a great night for the Toyota Prius and all Prius owners

2016-02-07: Why would they play “Sunday Bloody Sunday” at the Super Bowl?

2016-02-07: Leave it to high school Latin students to question the NFL over dropping the Roman numeral in Super …

2016-02-07: Larry David and @BellsBrewery Two Hearted Ale on SNL? These are two of my favorite things …

2016-02-01: What if we counted votes like this for all elections?

2016-01-30: Ugh. The fact they charge for parking at Wings Stadium is insane. No one is going to park in the …

2016-01-30: When paczki are half off at Sarkozy Bakery, you buy twice a much, right @MichiganGonzo? …

2016-01-29: Best plate ever? Great event for @VolunteerKzoo #edg2016 t.co/ViHm1VXBH…

2016-01-28: Just tuning in — Carson had the worst closing statement.

2016-01-28: The small can @MichiganGonzo! The small can! t.co/snyNrQVnc…

2016-01-28: Important information about Kalamazoo t.co/RE8hzPWaM…

2016-01-27: ugh t.co/3Dj7pjYRT…

2016-01-27: How do you make make your video look ammeture? Use default iMovie font! We’ve all done it, but for a …

2016-01-27: That original Flubber is pretty good

2016-01-26: It’s been a long time since I’ve gotten excited seeing a new podcast episode appear, but …

2016-01-22: .@GioBenitez: to clarify, @MLive is not a blog, it’s Michigan’s largest news organization.

2016-01-22: So the only question I have after #CapitolOffense — what translation of the Bible was Todd reading?

2016-01-22: Don’t take it off, Todd

2016-01-22: The woman, the legend, who works for a real news organization, @emilyjanelawler …

2016-01-22: FUCK THAT @MLIVE AINT NO BLOG

2016-01-22: Livingood, obvs t.co/rrXzHU8aQ…

2016-01-22: Hey ABC and #CapitolOffense: Plainwell is an amazing city with good people and amazing ice cream.

2016-01-22: Best part about the #CapitolOffense special is all the shots of @meijer.

2016-01-22: Death penalty anecdote? Really??

2016-01-22: We all fall…

2016-01-22: ABC bias anyone?

2016-01-22: Well this caps a shitty week for Michigan

2016-01-22: This shit is crazy

2016-01-21: Thinking of you @Kyle_Feldscher t.co/sjJHDmG9E…

2016-01-18: Drinking a L’Appel Du Vide Pear by @BellsBrewery at @bellsbrewery — t.co/cgbQlaxfA… …

2016-01-16: Is pork nature’s chocolate?

2016-01-15: So great to have the team back together for a night t.co/Z63t8bfiT…

2016-01-15: I see it. And the UP! t.co/yx8jg0OmI…

2016-01-14: I love this photo. It’s always great to collaborate with my coworkers in the brewery on photos like …

2016-01-13: I bought some Powerball tickets tonight. Even though I won’t win, I think it was a good thing… …

2016-01-13: Thoughts in line buying Powerball tickets So I bought some lottery tickets. I normally don’t. Growing up, my parents never played the lottery …

2016-01-13: So many cans… t.co/fpfbn7hiM…

2016-01-12: CNN sure does have some shaky cameras

2016-01-12: It keeps looking like Biden is giving Ryan life advice

2016-01-12: A little taste of the UP courtesy of @UpperHandBeer #yooper t.co/faKpGnZqa…

2016-01-11: t.co/WHw5utUC4…

2016-01-11: A #WMU student, too t.co/vSqX9i4F1…

2016-01-11: RIP #DavidBowie, from Michigan. My sister Kelsey​ had this license plate on her aptly named …

2016-01-11: David Bowie…

2016-01-09: Saturday night prog rock and coffee

2016-01-08: It’s always an amazing day when @DavidBowieReal comes out with a new album. Happy Birthday!

2016-01-02: The new YNAB YNAB is the budget app unlike no others: the only one I’ve found that really embraces the …

2015-12-31: Being from the midwest, it’s so hard to just write “Happy New Year” — I know it should have an ’s — …

2015-12-29: The Force is strong with out me mayor t.co/sXia2YGkG…

2015-12-28: Amazing, can’t wait to revisit my old stories… and see what @mciokajlo wrote in his day …

2015-12-28: “Crap” t.co/ZvWqdc53w…

2015-12-25: On your fifth screening of Star Wars your family makes you get the refills.

2015-12-24: .@wmubusterbronco and I grabbed some @PopeyesChicken on the road rooting on @WMU_Football at …

2015-12-17: t.co/BajOSzvyq…

2015-12-17: #tbt when I was tempted by the dark side… and candy t.co/jaWZWAgqa…

2015-12-14: As much as I love Star Wars, I’m setting up a filter on Twitter so I don’t see any spoilers

2015-12-08: Let’s hope everything gets cleared up at Catholic University t.co/WdBWnon5r…

2015-12-07: Too bad about the programs cut at @Dropbox — I always thought if @Mailbox supported Outlook, I would …

2015-12-06: And then the @BellsBrewery logo magically appeared on my glass… t.co/M8PQCbv9S…

2015-12-05: This is very exciting t.co/WMun7Dibc…

2015-12-05: Has Obama ever given a speech from the Oval Office?

2015-12-04: I have one item on my calendar today #EccentricDay t.co/XKxoGApdQ…

2015-12-02: Really, we should be praying for the families and guidance on what we can do to end future shootings …

2015-12-02: So many people my self included are so sickened by this and other shootings. But what can we do to …

2015-12-02: Are we ever going to be able to do something about this or let it become the new normal?

2015-12-02: This is so horrible

2015-12-02: Is this @starwars canon? t.co/lJ1JHpzjO…

2015-12-01: #heimkommen I can’t think of a movie I’ve seen recently that has envoked such emotion as this 106 …

2015-11-30: So sad to hear — prayers for her family t.co/K9fNKiEHO…

2015-11-30: My little Christmas tree makes it big social media debut t.co/O3BtNTYoQ…

2015-11-30: Duh t.co/MMxex2deI…

2015-11-29: Changes I haven’t posted here in several months and there’s some news: I’m no longer with MLive, but work …

2015-11-29: Well look at this: VHS is no longer recognized by autocorrect. t.co/v9CDoe0Xr…

2015-11-29: I will miss having @CaesuraLetters delivered daily, but excited to have more people take part and …

2015-11-27: Hmmm and he’s campaigned 8 times in the state which begins with an M… t.co/LkDQvHGLj…

2015-11-27: What a great @WMU_Football win by @Coach_Fleck and the team. #RTB

2015-11-27: What a horrible hit. Thoughts and prayers with Brown for a speedy recovery. t.co/0yE8LBuBz…

2015-11-27: What a great game #rtb

2015-11-27: Set up family sharing today. Forgot I had an Apple ID in college. Forgot about the music and apps I …

2015-11-27: Interesting history on Titus Bronson, founder of Kalamazoo, from @rosemaryreal …

2015-11-26: Still haven’t had Thanksgiving dinner yet. I’ve been snacking heavily. Here we go…

2015-11-26: What a great thing in Kalamazoo t.co/flcGl3bYf…

2015-11-26: The Clone Wars is an amazing show

2015-11-25: Man, I’ll miss Alex t.co/ItnbAADvV…

2015-11-25: Sunrise t.co/weryhZgnG…

2015-11-21: Wow Sparty!

2015-11-19: First…. of the season. t.co/dpgtMG7gt…

2015-11-19: Excellent, an amazing program t.co/Q1SCjyxy5…

2015-11-15: Just bought a book that included a free download of an audiobook… The format is .wma Seriously?!

2015-11-14: It feels so 1996.

2015-11-14: I mean, will people go to a .com site over a social media profile or just searching on Google?

2015-11-14: Why do candidates always mention their full website?

2015-11-14: Just turned on the debate. Oh my. I can’t stop hearing Larry David.

2015-11-14: Marathon reading @ Western Michigan University t.co/S6O09abfH…

2015-11-14: Sad to see what happened in Paris. Thoughts and prayers extended in full

2015-11-13: The @WMichClassics marathon reading of Homer’s “The Iliad” begins now at t.co/8lHQXGal8… …

2015-11-13: Every time I post something on the CMS, I go into a Mike + The Mechanics marathon. Sometime you do …

2015-11-12: Wow looks like it was a very interesting night on the Kalamazoo County Board.

2015-11-12: If @JustGetFlux goes on iOS, I think the iPad will be my primary device. Please let it on, @AppStore

2015-11-11: I’m really happy that the Broncos are on ESPN 2, but too bad the game is so late on a Wed night. …

2015-11-11: This is going to be a long long game #RTB

2015-11-11: I’ve been working on this series of videos for a while now… Here’s the first one. …

2015-11-11: Great catching up with my good friend @MichiganGonzo, and seeing the whole @Kzoo_Gazette crew! …

2015-11-10: Woah — Wisconsin the birthplace of the Republican Party? My Jackson friends must strongly disagree.

2015-11-10: Getting my car prepped for winter and have double the amount of brushes and scrappers — what to do …

2015-11-10: The most beautiful time of year @ Bell’s Brewery Logistics Center t.co/hSd29zBcp…

2015-11-09: It’s gotten to that temperature. t.co/wU0TyGlMm…

2015-11-08: Last days of Fall t.co/HC2wTaq5s…

2015-11-08: This is going to be great t.co/Gv7S2n7Ii…

2015-11-05: Is the @WMU_Football game streaming tonight? #RowTheBoat

2015-11-04: LIVE on #Periscope: Walk around bell’s t.co/nVFMvgoeb…

2015-11-04: What a night in Michigan

2015-11-03: Oh at 8:15 am I was voter #27 at Precinct 3.

2015-11-03: You know the day and what to do. t.co/hVkBkQb91…

2015-11-02: We always talk about about how happy All Stouts Day makes the people, but how about how happy it …

2015-10-31: What’s more annoying than anything else in the world, but a coffee shop playing “Monster Mash” over …

2015-10-29: When you start making stout jokes in the office, it’s time to go home

2015-10-27: The new font is looking great, @MLive

2015-10-26: Thank you for everything Torii

2015-10-22: Not fall yet @ B.O.B-Bells Other Building. t.co/gDo3fSL6o…

2015-10-21: .@VP Biden just said he’s “outtatime” for running for President, well played.

2015-10-20: Why can’t we Airdrop text between devices?

2015-10-19: Wow, a substantive trailer!

2015-10-19: 7 minutes!?

2015-10-19: Oh I get it now, they said tickets would be available online at halftime because that’s how long it …

2015-10-19: Not tonight, not for Star Wars. It’s where broken ticket sites and spoilers live. …

2015-10-19: Just bought my Star Wars tickets for @AlamoKzoo in person at theatre! Who needs the Internet! …

2015-10-19: Can’t wait! t.co/7ycXVGGsH…

2015-10-13: Everyone, this stream seems to be working: t.co/MQuOseLeb…

2015-10-13: Fox News couldn’t handle streaming a debate… neither can CNN.

2015-10-12: Some pitching change.

2015-10-11: Having a beautiful long weekend in DC t.co/Fd86JafuY…

2015-10-10: Wooooh close game #RTB

2015-10-10: Yeah @MichiganGonzo who’s leading now? t.co/KQZKeAyYY…

2015-10-10: . @JohnBCurran and I can’t be in Kalamazoo rowing the boat today, hope @JPughMI and @gkern feel …

2015-10-10: We need to have announcers that only describe WMU football games in nautical and rowing terms.

2015-10-10: This commentary on Rowing the Boat is hilarious. They are reading a lot into it

2015-10-10: Woah (@ Duccini’s in Washington, DC) t.co/iP3nkaBay… t.co/Z1Ioe4CHg…

2015-10-09: On point: Escape the 9 to 5 t.co/NWMHb19Kf…

2015-10-09: It was a blast… And here it is… By a horse t.co/sFY1T0TaL… …

2015-10-08: Wow. Good time to be going to DC

2015-10-06: All-day breakfast is a real thing t.co/DGGMRst2C…

2015-10-05: Amazing work by @MattMilcarek, @Hope4Kzoo and @KalPublicSafety! t.co/4utnGNdyY…

2015-10-03: Max!!!

2015-09-30: I can’t begin to tel you the number of dreams I’ve had about my trackpad breaking on my MacBook Pro

2015-09-29: Point of view. t.co/VpnuKSpsa…

2015-09-27: The moon looks like Mars

2015-09-27: The moon is a glowing coal

2015-09-26: Just saw this in Columbus. #MACstrong t.co/f8iXy47ff…

2015-09-26: Getting close to Columbus to #RowTheBoat with @WMU_Football, @Coach_Fleck and @wmubusterbronco …

2015-09-25: This has never happened: phone was at 1%, plugged it in, vibration went off and phone shut down. Not …

2015-09-24: Finally checking this place out. (@ Cooper Cafe) t.co/3QFSsWPjK…

2015-09-23: I’ve never ever ever seen a debate where one of the candidates refuses to answer the questions asked …

2015-09-23: Amazing — @Pontifex quoting MLK at White House.

2015-09-23: Also, will the Happy Birthday, public domain ruling change how Applebees cerebrate patrons’ …

2015-09-23: This is huge Happy birthday to you Happy birthday to you Federal judge rules ‘Happy …

2015-09-23: Good early morning again @jonathanoosting and @GRPBarton !!

2015-09-22: Visited here before. An amazing place. Can’t wait to hear about the Mass t.co/nD4gWYSEZ…

2015-09-22: Can’t begin to tell you how excited I am for @BellsBrewery #hopslam in cans. But let me show you my …

2015-09-22: But I really love the color modular face t.co/K0kKHzhyV…

2015-09-22: Or of dogs! t.co/1LTRo67vI…

2015-09-22: With WatchOS 2 I can make a custom @BellsBrewery watch face! t.co/4UQljeaJz…

2015-09-22: Love early mornings

2015-09-22: Last night was beautiful @ Bell’s Eccentric Cafe t.co/ggKBrUX4n…

2015-09-18: Great work @Kzoo_Gazette and @GRPress! t.co/3Yd2hhq9t…

2015-09-14: Oh what a beautiful morning t.co/Xi5dzy7wF…

2015-09-12: Let’s get this #Funvitational party started. t.co/agAq9kz71…

2015-09-11: There’s a rainbow downtown Kalamazoo tonight – looks like it ends at @BellsBrewery’s Eccentric …

2015-09-11: Great reporting, and stamina staying awake, from my friend @jonathanoosting on the scandal in …

2015-09-11: Setting up for #Funvitational #bells30th (@ Bell’s Funvitational - @bellsbrewery) …

2015-09-10: My oh Mead! - Drinking a Mead by @BellsBrewery - t.co/GINeiMfKQ… #photo

2015-09-10: Great bar serving some great Bell’s beer - Drinking a Quinannan Falls Lager at @shakespub - …

2015-09-09: Drinking a Best Brown Ale by @BellsBrewery at @bellsbrewery — t.co/EAKtixmp1… #photo

2015-09-09: Great to see @MichiganGonzo on the search for #mibest steakhouse. Had a Sweetwater donut & …

2015-09-08: Wait, there will be the Colbert premier, then a new Prius event, followed 12 hours later by the …

2015-09-08: This book from the 80s did not need a cover: Hot for Teacher t.co/XgITJJUDF…

2015-09-08: WHY OH WHY t.co/FyGcE7zt3…

2015-09-08: Made my iPhone font the LARGEST size – I really like it.

2015-09-07: I would love to hear C-3PO say “Uh oh Spaghetti-Os!” t.co/2hft7FJqB…

2015-09-07: Just realized I can use Apple Pay at the laundromat. Oh yeah

2015-09-07: Wow, this is an amazing album. Synthetica by Metric on @AppleMusic. t.co/gLZlX9zA0…

2015-09-05: Today was Octoberfest at Bell’s. Here is an Octoberfest-beer filter. t.co/qakquemwq…

2015-09-04: Great seeing TJ Duckett on the sidelines of tonight’s game.

2015-09-04: What other team rolls out to “The Chronic?”

2015-09-04: There are so many Spartan fans…

2015-09-04: One thing left to do today #RowTheBoat #BeatState t.co/Ikc5H4oeY…

2015-09-04: I’m never going to grow up #swooshswoosh #ForceFriday @starwars t.co/YIMuwA3vB…

2015-09-02: Signs that it’s still summer. t.co/8exH5xrhu…

2015-09-02: Great to see all the @MLive folk in #lovelansing. Sad that @Kyle_Feldscher is leaving Michigan. But …

2015-09-02: Unsung feature of @TextExpander: remembering your new phone number. ph#

2015-09-01: Love my street t.co/Xu9LCDbqb…

2015-08-31: A slight troll? cc: @ChrisGautz t.co/VuTCfy97P…

2015-08-30: Why is it that WMU doesn’t have any #RTB shirts on sale online? I’m ready to row on …

2015-08-29: Been so long, so very long. (@ Rugger’s Up & Under in Kalamazoo, MI) …

2015-08-29: The fences are down at WMU’s East Hall after what seems like years of construction and renovation.

2015-08-28: A regram from the bellsbrewery account. Can’t wait to try this beer. On the bottling line …

2015-08-26: Wait – first complete game since 2012? Glad he’s feeling better.

2015-08-26: I hope this means JV is back. If it’s the case, I’d take that any day.

2015-08-26: I’m streaming the game on MLB TV — turing off all notifications. Damn delay

2015-08-26: Cracking an obligatory Oberon

2015-08-26: Is this really happening? #gojvgo

2015-08-26: You can do it the old school way. RT @JohnDingell: If only there were a way to retweet yourself.

2015-08-26: Horrible, horrible: Reporter, photographer killed during Moneta, Va., shooting caught on live TV; 1 …

2015-08-23: Rainbow at Bronson Park @ Bronson Park t.co/ZQ3kaEwsg…

2015-08-22: So a progressive rock fan attends a jam band concert…

2015-08-21: Oh, I miss these trips and donuts too. You could always count on @gowesco t.co/MqPL877El…

2015-08-20: Octoberfest @ Bell’s Eccentric Cafe t.co/vwwiPhiNN…

2015-08-20: Something’s brewing. @ Bell’s Eccentric Cafe t.co/UIM29s0Xx…

2015-08-19: I’m getting a 27 inch monitor at work today…never really worked on anything bigger than 15 inches …

2015-08-18: The Sox?!?!

2015-08-18: A good example of slang making its way onto signage. @ Chicago Midway International Airport …

2015-08-17: There should really be a machine that reads credit cards and gives you a cup to pour your own …

2015-08-17: So much time has been wasted waiting in line for a cup of black coffee while frappuconos, sugar …

2015-08-16: What a city. t.co/aSUSENS7R…

2015-08-15: I’m at House of Shields in San Francisco, CA t.co/4NJu8zr9O…

2015-08-14: LIVE on #Periscope: 7th inning stretch at AT&T Park – Nationals vs Giants …

2015-08-14: I just realized that for everyone I’m texting, it’s nearly 11:30 – and not 8:30

2015-08-14: Insane comparison. t.co/sjLvfikuW…

2015-08-14: There was so much I wanted to say when I was traveling yesterday but had to stay on radio silence.

2015-08-14: So glad to be in San Francisco to surprise my buddy Jake for his birthday. Now I can break the …

2015-08-14: Wish I was there. Great program. t.co/P6DXTFqWP…

2015-08-13: I’m at Suppenküche - @suppenkuche in San Francisco, CA t.co/ZkV6zEbsr…

2015-08-13: What? t.co/I03MVqGcQ…

2015-08-11: One of those days where I’ve been under 20% battery the majority of the time.

2015-08-10: Woah t.co/dNGGUS01V…

2015-08-09: A lighthouse with no shore. @ New Buffalo Welcome Center Historical Marker t.co/4mXWEBAFx…

2015-08-09: Going to do some shopping in Wisconsin before coming home. Any beer recommendations?

2015-08-07: Hello, Madison. t.co/kTehUj7OL…

2015-08-07: I made it to Wisconsin! #gtmw t.co/DQPqR9CgI…

2015-08-07: Wow. What a story from @ChadLivengood. Just wow t.co/cDBdIeJz5…

2015-08-06: WTH Fox News: your live stream doesn’t work for the debate. This is the problem with one network …

2015-08-06: Is anyone else having problems logging into Fox News to watch the debate online? I hit stream and …

2015-08-04: First election in a while not being a journalist. Can’t shake the pizza. But hey, there’s beer now. …

2015-08-04: Almost forgot to vote. Voter number 132 downtown Kalamazoo at 1st United Methodist. Poll workers …

2015-08-04: Did anyone see this Dombrowski news coming?

2015-08-04: There’s an election today in Kalamazoo. Having recently moved back, I had no idea where to vote. …

2015-08-03: Oh my. There’s an election tomorrow in Kalamazoo.

2015-08-02: Looks like a potentially nasty storm is brewing in Kalamazoo. t.co/z1vJjfH3B…

2015-08-02: Just took a walk around downtown… It’s the calm before the storm

2015-08-01: It’s moving day in Kalamazoo’s Vine Street neighborhood.

2015-07-31: With four minutes to spare…

2015-07-30: Getting close and ready to #rockthenight5k at @SoldierField with @RAMRacing. Great benefit for …

2015-07-30: I saw @DAVIDprice14 open 4 times this year. Amazing to see. So glad we got to see him on Opening …

2015-07-30: So this means he’s now a Lugnut too? @Kyle_Feldscher @jonathanoosting @emilyjanelawler …

2015-07-29: New original Dr. Seuss book out! “What Pet Should I Get?” A question I’ve had the …

2015-07-28: So if Price pitches a crap game, does that mean the Tigers won’t sell him?

2015-07-28: .@JohnDingell Yes. Anything could happen. It’s going to be a long three days… Each MLB …

2015-07-28: I love these cool mornings before a hot day

2015-07-27: Well, time to crack open a beer #tigers

2015-07-26: Ok Tigers, it’s time to do or die

2015-07-26: My addiction continues. @amyonthetrail @MichiganGonzo it’s so good t.co/aIDLs7553…

2015-07-25: The Bell’s team is brewing at Makers Faire Detroit. @ Henry Ford Green Field Village …

2015-07-23: Let me tell you about allergies… t.co/XMEWsZNq0…

2015-07-23: Just got tickets for this @wmu_football season. Can’t wait to #RTB with @JohnBCurran and see …

2015-07-23: My favorite news source – Japanese publisher Nikkei to buy Financial Times in $1.29 billion …

2015-07-22: Move over coozie cam, meet the new fermenter cam… t.co/JlFNvNeaZ…

2015-07-22: Last Saturday night downtown Kalamazoo was a spectacular sight t.co/wVBl9FpjM…

2015-07-19: 😢

2015-07-19: Old home screens t.co/lzQjyfQ6t…

2015-07-18: Great morning on Goose taking photos of #BYCmac for Bell’s! t.co/iycThn4iH…

2015-07-16: People are saying a lot of mean things about @instagram being down. Cool down. Patience. It’s not …

2015-07-14: Huge t.co/Xhhtmq7G7…

2015-07-12: Is the season over?

2015-07-11: Everybody’s got a little light under the sun. t.co/RyV10gO5L…

2015-07-11: One of my favorite bands, one of my favorite places, at home. t.co/HCi1VFddO…

2015-07-10: Lunchtime Live, Taco Bob’s and saved a turtle. Great day #kzooltl t.co/a5nqDiRMd…

2015-07-10: Good morning from Bronson Park @ Bronson Park t.co/CahSLFVWK…

2015-07-09: New umbrellas. New angles for the sun. @ Bell’s Eccentric Cafe t.co/ADojPqTXn…

2015-07-08: 🎉🎂 t.co/lhUwt4CKk…

2015-07-07: A cool night. @ Bell’s Eccentric Cafe t.co/mjgfZ0Tmz…

2015-07-07: .@MichiganGonzo, I feel like we should visit t.co/obdWMmN6H…

2015-07-07: This was a fun video to put together: A tribute to the old @BellsBrewery Eccentric Cafe kitchen. …

2015-07-05: Seriously Siri, you can’t give me the score of the women’s #worldcup game t.co/ooLl9aZhZ…

2015-07-04: The question I have from today’s @Tigers game: when are same-sex couples going to appear on the kiss …

2015-07-04: I’ve been Apple Watched t.co/L6hxIAkt3…

2015-07-04: Greetings from up top @A2Jess! t.co/5jeOMgzNU…

2015-07-04: LIVE on #Periscope: Tigers 7th inning stretch t.co/vRAJCANsg…

2015-07-03: Having one of the best burgers in Michigan tonight. Guess who the cook is, @MichiganGonzo …

2015-06-30: .@Kyle_Feldscher t.co/ZgiCODUtz…

2015-06-30: Opened Beats Music for a second time and got this… Not good t.co/n03rNrFEo…

2015-06-30: Great first suggestions from Apple Music t.co/f2jr1zFPZ…

2015-06-28: After being incorrectly redirected trying to park at #ef2015, these guys made our day. …

2015-06-27: Just had the strangest thing happen. New message from a new contact. Appears on Apple Watch but not …

2015-06-27: Preservation Jazz Band is killing it at #EF2015 t.co/7OvbkCFoI…

2015-06-27: #bellsintheforest t.co/urXx7NzMj…

2015-06-26: Great to see the Ragbirds perform at #ef2015 t.co/nlTDp9GWm…

2015-06-26: LIVE on #Periscope: Getting ready for the largest group hug at Electric Forest #ef2015 …

2015-06-25: The calm before #ef2015. Can’t wait for the beer to start flowing. t.co/iU3Yuejwq…

2015-06-25: Yesterday this was a field. Today it’s a campground. #EF2015 t.co/sGC92UoDB…

2015-06-24: Look where we ended up tonight, @MichiganGonzo, @deb_klug t.co/Aqh4QIJko…

2015-06-24: Rolling into #EF2015 and Mike and the Mechanics is on the radio. Sweet!

2015-06-23: Nothing like a band that only sings about baseball. t.co/1L5oL4Dcn…

2015-06-23: Getting my bag ready for Electric Forest t.co/FlIjDtuiK…

2015-06-22: LIVE on #Periscope: Update in Kalamazoo t.co/9LfrhAXP8…

2015-06-22: The sirens have stopped downtown.

2015-06-22: What is everyone seeing in Kalamazoo? Pretty calm downtown…

2015-06-22: LIVE on #Periscope: Tornado warning in Kalamazoo t.co/hfWspEWDN…

2015-06-22: So true t.co/r83qZon7c…

2015-06-22: Good app to install t.co/p07qO95cp… t.co/fQIDMPPxy…

2015-06-22: It’s the calm before the storm. t.co/qaAj8orbX…

2015-06-22: Old reporter instinct: make sure computer is fully charged before storm.

2015-06-22: This storm is the size of Michigan and is covering Lake Michigan Yikes From @weathermanmark: …

2015-06-21: I wonder if this song by @sparksofficial was played during Mass at St Peters this morning… …

2015-06-21: Today is my 10,000th day on Earth.

2015-06-21: Alright. Let’s do this boys #Tigers

2015-06-20: So much chocolate.

2015-06-20: Seeing this makes me so happy.

2015-06-20:

2015-06-20: A 12 oz Oberon, of course! t.co/aPoCm3YrP…

2015-06-20: Nationals on, beer cracked, let’s do this

2015-06-20: Maybe I’ll start to use it now… or at least look at it. t.co/kjfskSbx5…

2015-06-20: Really sad to hear about the passing of Elson Floyd. A great leader who left a lasting legacy at WMU …

2015-06-19: Early morning pollination. @ Bell’s Eccentric Cafe t.co/Xn7kWTkBC…

2015-06-19: This is a fun watch t.co/Ygrq5j3a3…

2015-06-18: Excited to be coming back to Lansing tomorrow night for #festsunmoon2015, seeing good friends and …

2015-06-17: Miggy made it rain.

2015-06-17: My favorite weather app just got a whole lot better t.co/bWNDI14q9…

2015-06-17: Need to get some fans out in the field

2015-06-17: And it’s funny that you can use Apple Pay at Comerica Park but not with Comerica cards. I may need …

2015-06-17: Realized I forgot my wallet when I tried to check out at Walgreens… I did have two Apple Pay …

2015-06-13: And here it is! t.co/eJOBPvoL9…

2015-06-13: After a brief storm, everyone is on rainbow watch. #kalamazoopride #lovewhoyouare …

2015-06-13: Capturing a picture of three flags on a not so windy day is difficult.

2015-06-11: It’s been a good day for my Apple Watch t.co/4lHHHsXGZ…

2015-06-11: RIP Ornette Coleman

2015-06-11: Trying Black Owl Cafe and @KZooCoffeeCo for the first time in a long time. I hear it’s Michigan’s …

2015-06-10: A beautiful summer morning in Bronson Park t.co/i0jzoYxmZ…

2015-06-10: I never thought I would use two mail and two calendar apps on my phone.

2015-06-08: Just as I was tucking myself into bed… @FFS_MUSIC arrives t.co/RGUFuFo4K…

2015-06-08: I really like these Snow Leopard style updates.

2015-06-08: Wait didn’t Apple already try this music social network?

2015-06-08: Looks like I have to go back to San Francisco to try out the new Apple Maps app.

2015-06-07: Moving to a place with shared trash, I’m horrified by the things people throw away. Recycling really …

2015-06-07: My new apartment must have thinner walls… Bluetooth signal travels throughout.

2015-06-06: I hate when Tigers games have a national broadcast.

2015-06-06: Yes!

2015-06-06: Kalamazoo finally has a late night, downtown restaurant. t.co/YoyYAm5m1…

2015-06-05: BS t.co/SK5nM8WtV…

2015-06-05: Or, how I gained 11 pounds in 11 days. t.co/c3QKIaySq…

2015-06-04: The calm before the storm t.co/9GYW78mYh…

2015-06-04: Phantom tactics are a real thing.

2015-06-04: It’s officially official. t.co/D9fjh8m5D…

2015-06-04: What a great video. t.co/X30qLoN4u…

2015-06-03: Wait, did someone hold Obama’s microphone during the entire interview? t.co/Dt7ElbuLG…

2015-06-03: I love that JB wrote iPad, crossed it off and replaced it with an Apple Watch. …

2015-06-02: Ah. #oldmanklug t.co/FIviaJ4Qx…

2015-06-02: Wait there are apps that allow you to have a flash for selfies by flashing a bright white block …

2015-06-02: “shut and dance”? Mr DJ people are dancing. First all ages show I’ve been to in a long time.

2015-05-31: Had a great time judging #tasteofA2 with @MichiganGonzo – we tried a lot of great food and are …

2015-05-31: Doing some prep work before judging #tasteofa2 with @MichiganGonzo — can’t wait to taste the …

2015-05-28: In glad I didn’t stay up all night just to watch the Tigers.

2015-05-28: Such a great new single from @FFS_MUSIC. Come on now, give it a ring: t.co/A5c9HDUos… …

2015-05-26: What?! There are two gentlemen selling roses in Kalamazoo?

2015-05-26: Wait, does it gave a full touch surface? t.co/T2OAyPYwE…

2015-05-26: Hope everyone has a great time at #mpc15. Try a @BellsBrewery Big Porch Ale, available only on …

2015-05-23: !!! t.co/IP791hoV0…

2015-05-20: just moved and haven’t been able to set up cable. Antenna doesn’t pick up and live …

2015-05-19: I was excited to have a Walgreens open down the street from my house. But it closes at 10pm. Say …

2015-05-19: Signing up for new internet service. Wish me luck.

2015-05-19: Is Twitter trying to tell me something? CC: @jonathanoosting @Kyle_Feldscher @emilyjanelawler …

2015-05-19: That moment when you’re writing paper notes for the first time in years and write a …

2015-05-18: Had an amazing first day at @BellsBrewery. Can’t wait for what’s down the road.

2015-05-17: Enjoying a taste of Lansing in my new Kalamazoo apartment. Cheers @sleepwalkersa And thanks …

2015-05-16: In other news. I am hearing One Direction for the first time.

2015-05-16: Perfect summer night. t.co/TKlnmWmJk…

2015-05-16: I feel like I should tell everyone here to stop renting modems for $10 a month and buy their own.

2015-05-16: So many characters waiting in line here. Could learn a lot about humanity.

2015-05-16: Waiting 12 deep in line at Comcast just to return a cable box. Wish me luck….

2015-05-15: I’m in between jobs! t.co/7NuG7XubI…

2015-05-15: Nothing like one of #mibest donuts from Hinkley Bakery to kick off my last day at @mlive. Thanks …

2015-05-14: Heading to Jackson for one final #mibest stop with @MichiganGonzo s

2015-05-13: Today is the day on which the Phantom Menace came out closer to the Return of the Jedi than to the …

2015-05-13: Watch live: @MLive’s @jonathanoosting joins @fbtalk to talk Lansing politics t.co/B5fXoLKs1…

2015-05-13: .@fbtalk is live from the @mlive_lansing hub, now with @RepDanKildee t.co/wfdMv1Agq…

2015-05-12: .@CarlyFiorina was CEO of HP, speaking in Michigan, where its Gov, @onetoughnerd, was an executive …

2015-05-12: Interesting — @CarlyFiorina studied medieval history in college.

2015-05-12: Had a fun time at the #michamber dinner, and passing out the Michigan business history quiz …

2015-05-11: I think the cost of movers is greater than the cost of all my IKEA furniture.

2015-05-10: Happy Mother’s Day @deb_klug. We got Sweetwaters Donuts. Moms deserve MI’s Best, right …

2015-05-09: If I could make a custom Apple Watch clock face, it would be based off Boji Tower …

2015-05-09: It’s a great feeling when you come home and realize you’ve missed three seasons of “Comedians in …

2015-05-08: I just earned the ‘Photogenic Brew’ badge on @untappd! t.co/TW6ZalaGv…

2015-05-06: #yesbaby

2015-05-06: Tough decision. Who do I root for? My Lugnuts or the Whitecaps, the feeder team to my beloved …

2015-05-06: Whew, I would have been in trouble. “MLB Won’t Ban Fans From Using Periscope and Meerkat …

2015-05-06: An institution. Century-old Jackson Coney Island is closed t.co/HrQ0z5qMl…

2015-05-05: Will tonight be a footnote in Michigan political history?

2015-05-05: All that remains in our office tonight as we leave after Prop 1 coverage t.co/trt9k1Zyp…

2015-05-05: The time of election night where the result are in, people are writing stories, and twitter sloops …

2015-05-05: Just realized: when someone calls me on the phone, it rings four devices….

2015-05-05: A good reminder that all results are unofficial at this time… will be certified by board of …

2015-05-05: Let me put a pause on that last tweet. which was from the SOS website. Looks like Lake County has …

2015-05-05: With 38 counties reporting full results, Prop 1 passed in one county, Lake County, with 55 percent …

2015-05-05: The craziest thing about Prop 1 is that there is no real party divide. Reps and Dems both opposed …

2015-05-05: t.co/E1wH7u5jC…

2015-05-05: I wonder if Prop 1 will pass in any county…. or even get more than 25 percent support.

2015-05-05: There’s some Mich. winner tonight RT: @MichiganGonzo: Congrats @joshuadavis77 Top 5 of @NBCTheVoice …

2015-05-05: With only 3 counties having fully reported results, 867 people support Prop 1, with 13 percent …

2015-05-05: First numbers in from Kent county, with 9⁄247 precincts in, Prop 1 has only 21% support …

2015-05-05: .@MichiganGonzo I wonder if more people for Michigan’s @JoshuaDavis77 than for Michigan’s Prop 1

2015-05-05: Election night is a really bad night to keep Twitter notifications turned on my Apple Watch. …

2015-05-05: In all results I’ve seen so far, Prop 1 is down, with more than 70% opposed. Still a lot of votes, …

2015-05-05: With 104k votes in, Prop 1 still has 77% no in Oakland County

2015-05-05: With roughly 2,400 votes in from Macomb, 82.2% oppose Prop 1

2015-05-05: Follow Prop 1 live election results here. We’re collecting statewide numbers and top counties …

2015-05-05: First numbers are coming in from Oakland County…. t.co/tVpeXFQeL…

2015-05-05: Polls are closed in most of Michigan. Prop 1…. how will you fare?

2015-05-05: While I wait for polls to close…. t.co/LCgaHBUUL…

2015-05-05: My last election night and @NewsroomPizza as a journalist. t.co/HnoEtAO2L…

2015-05-05: And it appears the Ingham County website is down….

2015-05-05: Any consensus on a hash tag for tonight’s Prop 1 vote?

2015-05-05: Still confused about Prop 1? Take a look at this video. t.co/QZNPnVGNK…

2015-05-05: It felt so strange voting for just one question. Didn’t see anyone else voting in polling place.

2015-05-05: At 2:18, I was voter number 98 at Lansing Ward 4 Precinct 39

2015-05-05: Rain on an Election Day is never good for turnout. What will it do for today’s vote?

2015-05-05: Spelling out Kzoo to the Comcast agent makes me feel like I’m singing a Glenn Miller song.

2015-05-04: Excited to announce that I am going to work for @BellsBrewery in Kalamazoo! Thankful for everything …

2015-05-03: Happy World Press Freedom day t.co/D46vkOftE…

2015-05-02: Just posted a photo t.co/CqCqjoUv9…

2015-05-02: Glad to hear no reports of damage, injuries due to #mittenquake As we talk about it, remember that …

2015-05-02: Driving though Home Twp… But not staying

2015-05-02: Michigan earthquake measures 4.0 on Richter scale t.co/zxK66I9yo… t.co/hbxRckRiO…

2015-05-02: Earthquake with preliminary magnitude of 4.0 centered near Galesburg, Mich. - USGS via @breaking …

2015-05-01: Beautiful night for baseball with friends. @ Cooley Law School Stadium t.co/TBjJSD1G2…

2015-05-01: t.co/B2Gej6jrV…

2015-04-29: And the next Michigan’s Best search is… t.co/QDv4Kz0Jg…

2015-04-27: Nothing like waking up on Mackinac Island in the Grand Hotel and having a new @FFS_MUSIC song to …

2015-04-26: Cricket on Mackinac Island t.co/eiEItsMnr…

2015-04-26: Prep work for @behindthemitten with @MichiganGonzo and @amyonthetrail t.co/oUd6MmmvQ…

2015-04-26: Hello Mackinac Island! t.co/esuNV51TY…

2015-04-26: There is still snow on Mackinac Island t.co/OWEBwCY8D…

2015-04-25: Just found my favorite Michigan wine: Blue Franc from Shady Lane Cellars t.co/tUXdHu9pX…

2015-04-25: Beautiful Michigan day on @lpwines tour with @MichiganGonzo and @amyonthetrail …

2015-04-24: My Tigers… My Tigers

2015-04-24: Just saw someone walk down the street with a selfie stick and Louie Vuitton messenger bag

2015-04-24: If anyone in downtown Lansing wants to check out a real Apple Watch, come by the @mlive_lansing …

2015-04-24: Good prank @emilyjanelawler @kylefeldscher @jonathanoosting

2015-04-24: Everyone at work poked fun at my waiting for the UPS anxiety and got their “Apple Watches” “early” …

2015-04-24: This logo looks like @MLive t.co/fJQr0a575…

2015-04-22: I can’t trust this scoreboard #tigers t.co/vLOnjCgGO…

2015-04-22: At this rate we’re going to be at the game til 3 am

2015-04-22: LIVE on #Periscope: Snowing during the Tigers game t.co/lmbSxPUah…

2015-04-22: Snow…. In April t.co/tij5VgmH9…

2015-04-22: I’m looking to talk to any Michigan developers who have or are making apps for the Apple Watch. If …

2015-04-21: Go nuts! @lansinglugnuts ! t.co/uBHxhNDKx…

2015-04-21: LIVE on #Periscope: Lansing Lugnuts!!! t.co/UaEPe22O3…

2015-04-21: Yes. This is what snow looks like in April t.co/JIYoTaWPM…

2015-04-21: Flags are at half-staff across Michigan today to honor U.S. Sen. Robert P. Griffin, who died on …

2015-04-20: That’s my Tiger

2015-04-20: There is a tape out there with all my appearances. I was in middle school. Maybe some day it will …

2015-04-20: This is amazing news. The Screen Savers was the show that got me into tech. Asked several questions. …

2015-04-20: Remember what TS Eliot said: “April is the cruellest month”

2015-04-19: I wonder if these are Star Wars canon t.co/738Chhy4p… t.co/UbQi8DnKv…

2015-04-19: GRAND SLAM!

2015-04-18: Golden hour at the Capitol @ Michigan State Capitol t.co/dFjNqoBBI…

2015-04-18: Just spotted @MayorMikeDuggan at @smallplates

2015-04-17: I am so excited about new Star Wars.

2015-04-17: That’s my Tiger

2015-04-17: A 1997 pot bust t.co/u8T1oq6Ps…

2015-04-17: Sept 20 1997 “Kimiko” a llama from Clark Lake t.co/mUG9zUhUX…

2015-04-17: July 9 1997: Kids and a motorized car in Hemlock t.co/X55iQ6hX5…

2015-04-17: Aug 9 1997: An Air National Guard company from Grand Ledge tows a UH-1D helicopter …

2015-04-17: I was looking up some photos in the MLive archives and found some gems

2015-04-17: LIVE on #Periscope: Post Chinese food buffet thoughts and reaction t.co/nPf8obdTx…

2015-04-17: Carl Levin beat Griffin, a Republican, in 1978

2015-04-17: Per @RepDebDingell, Sen. Robert P. Griffin. Has died. He served Michigan from 1966–1979.

2015-04-16: Need to come up with a plan to consume all canon Star Wars material between now and Christmas….

2015-04-16: These kids are doing more for their “promposals” than most people do for their actual wedding …

2015-04-16: Things we didn’t think we would ever see again.

2015-04-16: One of the greatest things about the new Star Wars trailer is that it is showing us things we’ve …

2015-04-16: t.co/xLoEA6eUJ…

2015-04-16: My coworkers just saw me react to new a Star Wars trailer. They got to see a 5 year-old Fritz. I am …

2015-04-16: What a great time to be a Star Wars fan t.co/OUQzu9yur…

2015-04-16: Also @RepDebDingell and @RepFredUpton RT: @cspanJeremy: Spotted: @JohnDingell on the House floor. …

2015-04-16: And this is it today t.co/fLdVaDTwA…

2015-04-16: #tbt to a smaller iPhone and one of my first home screens. t.co/aZHuDsMxW…

2015-04-15: As much as I like watching a be Tigers on TV, nothing like hearing Jim Price use the term “Buggy …

2015-04-15: Nights like these are best t.co/CbtkPqKcn…

2015-04-15: (Too bad they ended their Classics program)

2015-04-15: This is my first time ever really walking the MSU campus. Beautiful place.

2015-04-15: Oh Apple Maps, how you fail me navigating MSU’s campus.

2015-04-15: Today we remember Abraham Lincoln. Here are all the different ways he is connected to Michigan …

2015-04-15: It’s spring time in the Capitol, and that means outdoor advocacy. Today: pro and anti Prop 1 …

2015-04-14: The exotic @meijer giraffe roams at sunset on Saginaw t.co/HaHJ0umHL…

2015-04-14: I would love to know the percentage of people who drive with their windows up or down, and how that …

2015-04-14: Michigan regiment was part of honor guard at Abraham Lincoln’s funeral #Fords150 …

2015-04-14: Trying out the new Kong app while at lunch t.co/YgxUD2es9… t.co/Q0OwHy0oV…

2015-04-14: Here are 5 other Michigan-related facts about Abraham Lincoln, from a story I wrote in 2012 …

2015-04-14: Here’s the story behind Abraham Lincoln and the term ‘Michigander’ …

2015-04-14: How Abraham Lincoln’s assassination chair ended up in Michigan at @thehenryford …

2015-04-13: And @Kyle_Feldscher walks home singing the @LansingLugnuts song

2015-04-13: RALLY CAP. RALLY CAP

2015-04-13: Yes, only so-called “fanboys” purchased the Apple Watch t.co/2JvNDNBeP…

2015-04-12: What a great weekend of baseball, family and friends. t.co/CTik1YSzP…

2015-04-12: I noticed a difference in roads crossing the Ohio-Michigan border. Not huge, but it was there.

2015-04-12: SWEEEEEP!

2015-04-12: LIVE on #Periscope: Tigers sweep!!!! t.co/A24p9MPvE…

2015-04-12: LIVE on #Periscope: A sunny 7th inning stretch at the Tigers-Indians game t.co/pmcTHfNDu…

2015-04-12: .@tigers #traditions t.co/tsXa6YZRN…

2015-04-12: Warming up t.co/HFwZWaO0l…

2015-04-12: Love coming to games in Cleveland. Look around and all I see is Tigers fans. t.co/1YcyCcHJE…

2015-04-12: IKEA will soon have new meatballs. t.co/yGo9XrouC…

2015-04-11: So you’re down 4 to the Tigers and you enter the bottom of the 9th with… Aretha …

2015-04-11: Something is going on near Quicken Loans Arena t.co/ykXY7CHyZ…

2015-04-11: LIVE on #Periscope: 7th inning stretch, Detroit Tigers vs Cleveland Indians t.co/N0s484S6I…

2015-04-11: I just earned the ‘Beer Gathering’ badge on @untappd! t.co/kExveNUno…

2015-04-11: I just earned the ‘Beer Party’ badge on @untappd! t.co/wheoH2qG6…

2015-04-11: Let’s go Tigers!

2015-04-11: LIVE on #Periscope: The Cleveland Indians old time band t.co/3jZfPZCrq…

2015-04-11: Hot dogs and baseball @ Progressive Field t.co/VUZo3fw95…

2015-04-11: LIVE on #Periscope: Checking out the new food And outfield additions at Progressive Field …

2015-04-11: .@tigers warming up in Cleveland to take on the @Indians. t.co/7dqHzFTk1…

2015-04-11: So many fellow @tigers fans here at the Ohio Turnpike rest area.

2015-04-11: I just rooted for the Red Sox

2015-04-10: It’s @LansingLugnuts Opening Day. To get pumped up, listen to t.co/zeZoL1LUF… & …

2015-04-10: I’m on time….

2015-04-09: I thought I was lost in AA but my senses always lead me to the best. Right @MichiganGonzo? …

2015-04-09: So pumped to see @Max_Raabe_PO in Ann Arbor. I’ve been a fan since I was 16 and finally get to see …

2015-04-09: Uh oh t.co/f6QXrWglc…

2015-04-06: And it’s a strikeout. Go Nathan, go

2015-04-06: Wow. Nathan just got booed. On Opening Day

2015-04-06: LIVE on #Periscope: Take me out to the ball game #tigers #openingdaydetroit t.co/3WNalimkX…

2015-04-06: This is a @JohnDingell quote, right? #OpeningDayDET t.co/Q47f4wG7F…

2015-04-06: Not too shabby, @tigers WIFI t.co/WXDmHLSN7…

2015-04-06: What is this thing called a “clock?” t.co/SJGxDopGD…

2015-04-06: LIVE on #Periscope: Introducing the Detroit Tigers… t.co/nhkS6CNdz…

2015-04-05: LIVE on #Periscope: The Go Arounds live in Kalamazoo t.co/VMTDz4ixX…

2015-04-05: I just earned the ‘Land of the Free’ badge on @untappd! t.co/pUyfs0F7p…

2015-04-05: Χριστός ἀνέστη!

2015-04-04: ? t.co/IN6wf7zz6…

2015-04-04: My boys. Best run.

2015-04-04: LIVE on #Periscope: Walking downtown Kalamazoo to meet my friends and watch the MSU Final Four game …

2015-04-04: At a bar and in hearing “Let it Go” for the first time….

2015-04-04: LIVE on #Periscope: A duck wanders downtown Lansing t.co/UnObhXeXt…

2015-04-04: Easter egg hunt on the Capitol lawn! t.co/VOBBJkMuQ…

2015-04-03: Watching “The Iron Giant” for the first time. What a great film

2015-04-03: See you this weekend t.co/UUK973pcK…

2015-04-03: Just posted a photo t.co/hbhPVBSDI…

2015-04-03: Some true Spartan-Easter Bunnny spirit spotted in downtown Lansing today. #MSU #spartans …

2015-04-03: Nice napkin @capcityfilmfest Can’t wait for the films next weekend t.co/dBFajmowG…

2015-04-03: I have not had so much fun on a social media platform as I’ve been having in the past 24 hours with …

2015-04-03: LIVE on #Periscope: Ask me anything about Michigan’s Prop 1 and road funding. …

2015-04-03: Have a question about Prop 1? I will be live in 15 minutes (2:33) to take your questions and talk …

2015-04-03: LIVE on #Periscope: Checking out Lansing’s latest food place: Henry’s on the Square …

2015-04-03: LIVE on #Periscope: Inside the tap system at Beer Grotto t.co/cN5fBGDPw…

2015-04-03: LIVE on #Periscope: Checking out the new Lansing Beer Grotto @beergrotto t.co/ntIllphaP…

2015-04-03: LIVE on #Periscope: Testing rotation t.co/VIVBoBQ0r…

2015-04-02: Great to be back at the Wagon Wheel with @MichiganGonzo t.co/FaYsOb22c…

2015-04-02: Hmmm where can we be? RT @MichiganGonzo: Meeting @fritzklug for a burger! Find out where!! Live on …

2015-04-01: Interview on Poynter What a great honor to be interviewed by Melody Kramer for Poynter about my work in digital …

2015-03-31: Wow, new EPIC-MRA poll shows Prop 1 opposed 2⁄3 and 7⁄10 after hearing ballot language.

2015-03-31: Hahaha hey @MichiganGonzo and @amyonthetrail! We’re watching in @mlive_lansing (I was tempted to …

2015-03-31: And thanks to @andrewmdooley for connecting @mkramer and I on Twitter

2015-03-31: Thanks to @mkramer and @Poynter for the nice article about the work we’re doing here in Michigan at …

2015-03-31: First sign @ Lansing River Trail t.co/bIRiEz5Ue…

2015-03-30: Flying Michigan State bagels, the gif #bagelsnotcouches t.co/GcXCXBVfD…

2015-03-29: Police in riot gear selfies and photo ops t.co/7K53VwZqq…

2015-03-29: Here is full video of when the police broke up the East Lansing Elite Eight celebration …

2015-03-29: Uploading photos and videos from the “celebration” — can’t begin to tell you how many people took …

2015-03-29: This is a first: I’m filling my story from church before service

2015-03-29: Bagels? t.co/e7z4iRJDQ…

2015-03-29: A fire and arrests. t.co/K83aO1IFi…

2015-03-29: All is done. Had poor reception. Couldn’t tweet.

2015-03-29: Chants continue.

2015-03-29: Fire started. Looks like multiple arrests. Crowd off the street

2015-03-29: The sad thing is that everyone is cheering as Spartans but the school does not offer a major in the …

2015-03-29: Crowd is kinda hanging around now. Chanting. And there’s snow. t.co/zD2DRsALu…

2015-03-29: You can hear the cheering from the street.

2015-03-29: . @emilyjanelawler and I are in EL awaiting for the game to end. Police are already waiting around. …

2015-03-28: I become the old man when they say “I want 80s music” I play “don’t you want me baby” They look …

2015-03-27: Flurries.

2015-03-27: What a morning for news alerts

2015-03-25: I caught myself singing “A Whole New World” tonight. Thanks @Kyle_Feldscher

2015-03-25: But who will call it this? Wings Stadium changes name to Wings Event Center t.co/ASMlHmDRC…

2015-03-25: This is so Brave New World: you mention the book to a friend and he said he’s never read it, but …

2015-03-25: I never know how to respond when people hear my name and ask if I’ve heard of “Fritz the Cat”

2015-03-23: Just like Eccentric Day is a better Halloween, Oberon Day is a better St Patrick’s Day.

2015-03-23: This day warms my Kalamazoo heart. t.co/KBbS5MOWe…

2015-03-23: Live with Gov Snyder t.co/KSZ7QApJn…

2015-03-23: Starting soon: @onetoughnerd sits down w/ @jonathanoosting to answer @MLive questions on roads …

2015-03-23: |LIVE NOW| #meerkat t.co/47LDR5U93…

2015-03-23: Four hours til we are live with @onetoughnerd at @mlive_lansing t.co/VGSYdI1qd… …

2015-03-21: Lansing police investigating death on River Trail per @wilxTV t.co/O7axpgj7f… Took these pics …

2015-03-21: Also, I feel like the oldest person down here

2015-03-21: Downtown Lansing is as busy as any session day.

2015-03-19: Snyder on Prop 1: “Let’s just get er done.”

2015-03-19: Snyder on Prop 1, holding piece of road and bridge. “Can you imagine one of these coming through …

2015-03-19: Rest in peace, Bob Parlocha t.co/ruZEXWalz…

2015-03-19: Rest in peace, Bob Parlocha I grew up listening to NPR. During the day, our local station WMUK had a classical music program and …

2015-03-18: I can’t begin to tell you how excited I am that my company has switched over to Office 365. …

2015-03-17: Oh St. Patrick’s Day. I’ve been to one bar but it feels like twenty.

2015-03-17: I can’t wait. t.co/YNpkkYdiS… t.co/sSSPU7IAr…

2015-03-17: The dichotomy of folks downtown Lansing celebrating St Patrick’s Day and working for the state is …

2015-03-17: What is most interesting about Apple Watch packaging image 9to5 Mac published an interesting image from Apple’s jobs website of potential Apple Watch …

2015-03-15: Beware….

2015-03-14: Three months with @ulyssesapp for iPad. My favorite writing application has now become my only …

2015-03-13: I see @onetoughnerd is celebrating Pi Day a day early t.co/L9b22b5TO…

2015-03-12: I was wondering about this “Farrell” player the MLB app kept notifying my about. A young one who …

2015-03-12: Ulysses for iPad [caption id=“attachment_935” align=“alignright” width=“620”]A …

2015-03-12: Wow, I’ve never seen a website “excluded” from the Wayback Machine

2015-03-12: Rouge One!

2015-03-12: From the wire. WARREN, Mich. (AP) - Relative: Marine from Michigan among 11 killed when helicopter …

2015-03-12: "Mornings with King Crimson" If I had to describe this time in my life… it would be “Mornings with King …

2015-03-11: Watching the sunset t.co/InCw1C6o5…

2015-03-11: I’ve recently updated my online portfolio. Check it out: t.co/8KDZq3P4H…

2015-03-11: The circle of life continues in downtown Lansing.. new donut shop, new deli, new farm to table …

2015-03-11: I went to both Jimmy Johns and the Peanut Shop yesterday. Just realized both totals were exactly …

2015-03-09: Today marks two years since I’ve moved to Lansing. It’s amazing how fast and how slow …

2015-03-09: Vunteering right now. Missing my first Apple event in years. For a good cause (and thank you Twitter …

2015-03-08: Sun is shining, all the windows are open, Tigers game on the radio. Never felt so good.

2015-03-08: It didn’t feel like I slept in to 9:30… oh wait it was really 8:30. DST. Go back to sleep?

2015-03-07: Had to check out the best party store in Comstock Park with @tinynotebook. Of course @MichiganGonzo …

2015-03-06: Happy Friday t.co/4frj2kYxn…

2015-03-05: Wait… There’s going to be a Blade Runner sequel?

2015-03-05: Oh Harrison Ford, hope you are OK

2015-03-05: With Candice Miller retiring, Michigan will lose 14 years of experience.

2015-03-05: Charging older users more money to use premium Tinder? What? Any other services do this? …

2015-03-05: Wow, can’t wait to see “Mr. Holmes” t.co/x09xACmgP…

2015-03-05: I forgot the hysteria of 1999. And a Michigan church, too Y2K Time Bomb: Classic Evangelical …

2015-03-05: Kalamazoo has Michigan’s Best coffee shop @MichiganGonzo’s list: t.co/myBFZ5fFk…

2015-03-05: I dreamt my car was totally covered in ice. Like underwater ice. Winter has gone too far

2015-03-04: Getting ready to head on 1320 WILS Morning Wakeup/Lansing with Dave Akerly

2015-03-03: I’m so happy to be hearing Detroit @tigers baseball on the radio

2015-03-03: It feels like salt is falling from the sky

2015-03-03: Just think… In a couple months we may be able to keep the windows open all day

2015-03-03: Here’s the basics on the May 5 vote to raise the sales tax to give more funding to the roads. …

2015-03-02: If a baseball game is not in TV, streamed or on radio, does it really happen?

2015-02-28: Golden hour and closing time t.co/pCnnixhWs…

2015-02-28: Lines are long at beer fest t.co/1Yo6I4KAQ…

2015-02-28: Do I have a pretzel necklace for you @MichiganGonzo t.co/SYHG5WOsJ…

2015-02-28: I was at Founders last night and within 20 minutes, someone from Chicago and another from Cleveland …

2015-02-28: I’m in Grand Rapids this weekend for the @MiBrewersGuild #MIWBF15

2015-02-27: Obama statement on passing of Leonard Nimoy t.co/tWm4ZZITf…

2015-02-27: .@MichiganGonzo on #mibestcoffee search t.co/punp0Wtnb…

2015-02-27: Live long and prosper

2015-02-26: What color is the dress? I don’t know, it’s late and I’m using @JustGetFlux

2015-02-26: I saw someone at the game looking at a picture of the dress the entire time.

2015-02-26: This whole rooting for college teams whose schools have the best Classics program is tough in East …

2015-02-26: Had a great time at @strangematterco today w/ @MichiganGonzo. Here’s a timelapse video of a pour …

2015-02-26: And look who it is! @MikeGriffith32 drinking green tea, eating oatmeal and writing. #mibestcoffee …

2015-02-26: Coffee, books and @MichiganGonzo #mibestcoffee t.co/5S6mDz39X…

2015-02-26: And now to Bestsellers in Mason, home of @MikeGriffith32 t.co/vFHGyvkqp…

2015-02-26: This cold brew NOLA coffee at @strangematterco was amazing. #mibestcoffee t.co/CR66Pq6UR…

2015-02-26: Excited to spend the day with @MichiganGonzo on the #mibest trail. First stop: @strangematterco …

2015-02-26: Tahquamenon Falls, from rushing water to covered in ice. How did it form? t.co/zW3MTqgZO… … …

2015-02-25: Just heard in the @mlive_lansing office: the “You’ve Got Mail” sound. Won’t say whose computer it …

2015-02-25: These are amazing: “Early 20th-Century Japanese Ads for Beer, Smokes & Sake” …

2015-02-25: How cold is it? Cold enough for Tahquamenon Falls to be fully covered by ice See more photos …

2015-02-24: The bridge is expected to be closed for several hours.

2015-02-24: The Mackinac Bridge is closed for multi-vehicle crash. White out conditions. Look at the cameras. …

2015-02-23: Going to be a long night of CSS and King Crimson

2015-02-23: So I’ve been on the phone for the past three hours and the Oscars have been on mute. Have I missed …

2015-02-20: This is great: Confessions of an iPhone 6 t.co/fpKDzPitT…

2015-02-19: Congrats to @strangematterco for winning the #mibest coffee poll for Lansing. @MichiganGonzo …

2015-02-19: Christmas music is being played at Biggby….

2015-02-18: Search Michigan community coffee shops nominated for Michigan’s Best t.co/bPr5WdgSC… …

2015-02-17: You know, I could RT everything @Snoopy tweets

2015-02-17: Let the countdown begin RT @tigers: @fritzklug Only 48 days until #OpeningDayDET!

2015-02-17: I can’t begin to tell you how happy I just got thinking that in a few months, I will be watching the …

2015-02-17: Here’s video of the break t.co/8CXPHu0eV…

2015-02-17: Water main break downtown at MSU credit union. Water rushing out of the building. …

2015-02-17: I 🙏 not

2015-02-17: Wait — 🙏 is high five and not praying? Is what @Kyle_Feldscher and @AndreaBitely told me true???

2015-02-17: Play hard RT @Snoopy: Work hard. 📚 t.co/k7EDhTq3C…

2015-02-16: Sunset and streetlights. t.co/mlKDbXoDc…

2015-02-16: Infographic RT: @SlateVault: Illustrated biographical map of Lincoln’s life, published in 1934 …

2015-02-16: Happy Presidents Day: 6 Michigan connections to the Oval Office t.co/A0sE8Lu6n… …

2015-02-16: A shot of the Capitol on Saturday. So very cold. Almost was blown over. @ Michigan State Capitol …

2015-02-15: They still have it.

2015-02-15: That was about tanning beds, right?

2015-02-15: Like most episodes of SNL, the commercial breaks seem to become longer and more frequent.

2015-02-15: Seeing the top half of Larry David’s head is entertaining.

2015-02-15: Eddie Murphy was awkward but not surprising — he didn’t like SNL for a long time. He still may not …

2015-02-15: So sunny and so cold

2015-02-15: Staying in t.co/H3lx79ccA…

2015-02-14: Can’t think of any other band who with their very first song had such a massive, epic sound as …

2015-02-14: Starting the Valentine’s Day, King Crimson Marathon right….now 21st Century Schizoid Man!!!! …

2015-02-14: I found a very #rowtheboat valentine… t.co/1uM0DjV3X…

2015-02-14: I ‘lake’ the effect you have on me: 28 Michigan-themed Valentines: …

2015-02-13: New Mew! t.co/zzwZe11Wa…

2015-02-13: Four hours left to nominate coffee shops for Michigan’s Best Coffee Shop. Where should …

2015-02-13: . @Kyle_Feldscher and I just ordered “the Coach” — @coach_fleck’s drink of choice at @BIGGBYCOFFEE …

2015-02-13: As @Kyle_Feldscher and I are trying to order the Coach, we have to go to another Biggbe

2015-02-13: Send me your ideas for Michigan-themed Valentines #MIvalentine

2015-02-13: 9 more Michigan-themed Valentines added, check them out: t.co/UWK9oZ3lR… #MIvalentine …

2015-02-13: Guess what we are doing today @Kyle_Feldscher t.co/lh41LLQRJ…

2015-02-12: Terribly saddened to hear about the passing of @carr2n

2015-02-12: We have more #MIvalentines coming

2015-02-12: Be #MIvalentine Check out more Michigan-theme Valentines: t.co/iCSqr0rZe… …

2015-02-11: We’re live again with the @MLive @MILottery show!!! With new and improved technology! …

2015-02-11: I need one more number for my Twitter Powerball ticket…

2015-02-11: I mean, what harm would be caused if Netflix just released House of Cards right now?

2015-02-11: Don’t tell @deb_klug but I bought a lottery ticket t.co/JIWockdmH…

2015-02-11: Buying a lotto ticket. First 5 people who send me a number will be on the ticket.

2015-02-11: Even before #mibest coffee, @michigangonzo is a little goofy. t.co/RbWv1oARh…

2015-02-11: I think @MichiganGonzo kinda looks like an Oompa Loompa in his new profile photo …

2015-02-11: Snow high top @ Michigan State Capitol t.co/W16jP2Omi…

2015-02-11: For someone from Michigan to win the #Powerball, each 18+ resident would have to buy 23 tickets. …

2015-02-11: I just made some coffee — French press, freshly ground beans. Looking at my arsenal, I could make …

2015-02-11: The next #mibest search: Coffee shop. Where should @MichiganGonzo go? t.co/ANIBnSfgq…

2015-02-10: So much for going to bed early tonight. Going to watch the Daily Show

2015-02-10: Lost glove at the MLive office. @emilyjanelawler let’s find the owner. #glovelansing

2015-02-10: What’s the first thing you would do if you won tomorrow’s @Powerball jackpot?

2015-02-10: Have any questions about #Powerball? Join @MichiganGonzo and the @MILottery for a live chat tomorrow …

2015-02-09: Say this ain’t so for #rowtheboat t.co/TaSjOZ1QM…

2015-02-09: Beautiful animated map of global wind, weather, and ocean conditions t.co/5OqeWThVC…

2015-02-09: Just successfully quoted Taylor Swift in defending myself.

2015-02-09: Go to get pie, see @GriffandGrinz @MikeGriffith32 t.co/qEhdGVUUz…

2015-02-09: The Washington Square food odyssey continues with @jonathanoosting t.co/igcf4Wqdu…

2015-02-09: Or enough of Michigan’s Best Burger for every Michigander… for a work week

2015-02-09: If you won the $450 million Powerball, you could buy 38 million 6 packs of Bell’s Two Hearted …

2015-02-09: Damn you, autoplay videos.

2015-02-09: I have never heard this recording before, a delightful way to start off the week …

2015-02-08: Social media reporter?

2015-02-08: So how did Coldplay get in this category?

2015-02-08: Siri, you’re not really cutting it anymore t.co/ccNZROGhZ…

2015-02-08: The New York Times Had a Mistake on Its Front Page Every Day for More Than a Century …

2015-02-07: Our live Powerball show has begun! With @MichiganGonzo t.co/3UiN1wQfz… t.co/8z4ieZGU4…

2015-02-07: Late night with @michigangonzo t.co/Alrm25mSl…

2015-02-07: Excited to make broth for soup today. @Kyle_Feldscher and @emilyjanelawler don’t seem to …

2015-02-04: Enjoying a night cap from @SleepwalkerSA with @MichiganGonzo t.co/kylirhd8a…

2015-02-04: #rowtheboat t.co/yehxwrrY6…

2015-02-04: #rowtheboat t.co/168CeZYIH…

2015-02-04: In Detroit to live stream signing day… But DPS is closed and there’s only journalists …

2015-02-02: Wow. Looks like everything is closed tomorrow in Lansing. This snow won’t stop

2015-02-01: Just drove from Kalamazoo to Lansing. 30-45 mph the whole way. Took two and a half hours.

2015-01-30: In preparing for Romney’s announcement, I put together a Michigan gallery from the archives. …

2015-01-30: With Mitt Romney not running again for president, here’s a look at his family’s history with …

2015-01-29: Salt, The Defender t.co/AOue0s6uA…

2015-01-29: Look what came in the mail today at @mlive_lansing, @TruscottRossman t.co/eGUg7Bvhl…

2015-01-29: .@dustinblock is about to go on air with Paul W. Smith #wjrlive t.co/XlK0Ij76v…

2015-01-29: .@onetoughnerd is live now #wjrlive t.co/Y2wNW7tAG…

2015-01-29: Lansing Mayor @vbernero talks to @wjrradio #WJRLive t.co/yCpfJsrkw…

2015-01-29: First guest is David West — #PureMichigan VP #wjrlive t.co/K7eFBf7nx…

2015-01-29: And we’re live with the Paul W Smith @paulwjr show at @mlive_lansing #wjrlive t.co/TYBMwtZev…

2015-01-28: The @MiBaseballHall is coming to Lansing this summer t.co/O7ilXIZ1d…

2015-01-28: Great @CaesuraLetters this morning: What makes human language unique. Why We Are Defined By Things …

2015-01-27: More Michiganders have signed up for health care under the ACA than all of last period. Search sign …

2015-01-27: Share your photos from Michigan’s epic, newly-named Iron Belle trail #ironbelle …

2015-01-26: Hey @Kzoo_Gazette peps, guess what. Construction is starting above the @mlive_lansing hub. I thought …

2015-01-26: This guy wishes Michigan a Happy Birthday. t.co/Awkb2ZlYq…

2015-01-26: It feels strange to see the internet freak out about a major snowstorm and nothing is predicted to …

2015-01-26: Last week, we quizzed you on civics. Today, on Michigan’s 178th birthday, we ask: how well do you …

2015-01-26: So Michigan isn’t getting any of this snow?

2015-01-26: Happy 178th Birthday, Michigan: t.co/MGYckLx9O…

2015-01-26: When I hear “Iron Belle,” though, I think it’s a story about a young Margaret Thatcher

2015-01-26: Michigan’s epic trail from Belle Isle (Detroit) to Iron Wood (Upper Peninsula) has a name: …

2015-01-23: To become a U.S. citizen, you have to pass a civics exam. How well do you know Michigan? Take our …

2015-01-20: State of the state of the Union t.co/ZdJjt3S0H…

2015-01-20: And I’m imagining it’s too much of a good thing.

2015-01-20: This is strange having State of the State followed by the State of the Union

2015-01-20: Fred Upton, Paul Ryan, sitting together and shook Obama’s hand.

2015-01-20: Another GIF: @briancalley snapping a pic of @onetoughnerd before #MISOTS15 t.co/eARL5fbJI…

2015-01-20: We’re GIFing the #misots15 – here’s the first one: @onetoughnerd rolls away from …

2015-01-20: I want to be a Techno Dragon

2015-01-20: #RiverofOpportunity would have been an excellent campaign slogan

2015-01-20: I’m doing everything double tonight — packed two dinners, two computers. #MISOTS15 #SOTU #StatesOf

2015-01-20: Just dropped off the @MLive Michigan’s Best Pie award to @sweetie_licious in Dewitt with …

2015-01-20: Tonight is the night of the two States: State of the Union and State of the State. It’s going to be …

2015-01-20: Nearly two years later I do not understand the shift icon in iOS

2015-01-19: Report: Max Scherzer agrees to seven-year deal with Washington Nationals: I held out hope… …

2015-01-18: There’s hot yoga above Kewpee’s. I wonder if there’s a deal on lessons of you …

2015-01-16: Time really flies when it ain’t that much time. @sparksofficial t.co/24z6kyoIE…

2015-01-16: On the sidewalk outside the Michigan Capitol. t.co/FcQkj97eq…

2015-01-16: This is what happens when you try button your jacket while texting. You join the wrong ones. …

2015-01-15: Can’t believe the Lego Movie was snubbed by the Academy. Oh well. EVERYTHING IS AWESOME

2015-01-14: Nothing like opening the App Store and seeing one of your favorite and most used apps with a 2.0 …

2015-01-14: .@SleepwalkerSA is a great brewery — they have a prune beer. Glad to have it in Lansing. …

2015-01-14: Covered House & Senate swearing in ceremonies today. Here’s 33 photos & …

2015-01-14: Now for the swearing in of the Michigan House. Floor is full with reps, friends and family. …

2015-01-14: Swearing in day at the Capitol. Lots of family and friends of legislators. Up now is the Senate …

2015-01-14: At least it’s rising t.co/zQBoWfVdR…

2015-01-12: .@onetoughnerd talks to media before signing roads bill into law t.co/TFtaSTK9D…

2015-01-09: Beautiful flight with a beautiful app on my iPad. @ulyssesapp t.co/NJEi5C6EC…

2015-01-07: Made it to Oregon #bcb

2015-01-07: Ionic column at the Lincoln Memorial @ Lincoln Memorial t.co/8xMnD8ULp…

2015-01-06: Five course meal of some of the best food I’ve ever had. #bcb (at @Graffiato in Washington, …

2015-01-06: 2015: Spending more time in silence I don't really like New Year's resolutions: not a lot changes from Dec. 31 to Jan 1. But …

2015-01-05: Underground. #bcb (at @BohemianCaverns for Bohemian Caverns Jazz Orchestra in Washington, DC) …

2015-01-04: Crab chips and kombucha.

2015-01-04: I just earned the ‘Happy Brew Year (2015)’ badge on @untappd! t.co/WJoOP7Ufr… …

2015-01-03: The Capitol, under renovation and under fog. t.co/5dbzrgjpp…

2015-01-03: 'The Best BlackBerry Ever Made' The Wall Street Journal has a review of a new BlackBerry phone. It looks great. I love my iPhone, …

2015-01-02: Pretty cool seeing the Michigan Capitol as I took off from @flylansing and the National Capitol …

2015-01-02: Plane is deboardong from Dallas in Lansing. Waiting to see someone not wearing green or white.

2015-01-02: The signs for Rep’s parking spots have been changed from including their name to just district …

2015-01-02: Less than 24 hours after the inauguration, the Michigan Capitol is almost back to its normal state. …

2015-01-01: Stop texting and walking From the New York Times: Message to Self: In 2015, Stop Texting While Walking I’ve had a few …

2015-01-01: Day 1: January 1, 2015 [caption id=“attachment_911” align=“aligncenter” width=“620”] I …

2015-01-01: Mich Gov. @onetoughnerd to be sworn in for 2nd term; watch 2015 online via @jonathanoosting …

2015-01-01: .@onetoughnerd gets a run through before today’s inauguration t.co/WD7m584i8…

2014-12-31: Why doesn’t Apple TV have w visualizer for music like iTunes does?

2014-12-31: Have you noticed that when you send a text message using voice dictation, it’s usually a lot longer …

2014-12-30: 'Being a Kardashian helps, too.' Gary Silverman writing in the Financial Times: I just worry about where we are heading. This …

2014-12-27: I just earned the ‘Merry Brew-mas (2014)’ badge on @untappd! t.co/AKhHmgPFX… …

2014-12-25: Who put the sheep up there? t.co/z37Zi0tYi…

2014-12-23: Oh, hi, oh. t.co/mdSI7SLdY…

2014-12-23: It may be two days before Christmas, but this is the perfect song t.co/DKsNmYeGS…

2014-12-22: The stage is being set for Jan 1 inauguration of @onetoughnerd, @briancalley, @SchuetteOnDuty, …

2014-12-22: How many words makes a good story? Don't focus on 'longform' Marco Arment made a solid point in his post about the recent popularity of “long-form …

2014-12-21: My original GoPro dog mount [caption id=“attachment_874” align=“aligncenter” width=“620”] …

2014-12-21: The “snaketivity” has arrived at the Michigan Capitol t.co/oH6EQGETr…

2014-12-20: And this is how you do not #RowTheBoat t.co/4wQjFw8f0…

2014-12-20: Tough loss for @WMU_Football, but for the record, this is how you #RowTheBoat t.co/biYSqP4Fn…

2014-12-20: The announcers just said “these are fired up Cadets” …ouch

2014-12-20: That’s one (sc)ore. We need another. #rtb

2014-12-20: Those Broncos on the sidelines look like Jedis in those raincoats #rowtheboat #rowrowrow #MyWMU

2014-12-20: Nothing quite as depressing as walking downtown Lansing on a Sat night, it’s empty and “Have …

2014-12-20: DID ESPN JUST SAY BRONCOS DONT STUDY????? OH NO THEY DIDNT #rowtheboat #mywmu

2014-12-20: .@gkern I’m there in spirit. Even have my own @wmubusterbronco t.co/ekEuGY0Cy…

2014-12-20: Last year, I never thought the Broncos would be in a bowl game right now.

2014-12-19: .@MIGOP chairman @BobbySchostak not seeking another term as party chairman

2014-12-19: The nativity scene has arrived at the Michigan Capitol t.co/nnMfcbL49…

2014-12-19: Great work from colleagues @jonathanoosting and @emilyjanelawler for staying up all night in the …

2014-12-18: Hey! Shout out to Saginaw Spirits in final Colbert Report!

2014-12-18: Ice in Lansing, 2 t.co/4LK2Bgrm3…

2014-12-18: Ice in Lansing, 1 t.co/TENLbgYp8…

2014-12-18: Or a GIF showing the stress #lameduck deal making has on your face t.co/ZBSpM6JLk…

2014-12-18: Who doesn’t want a GIF of @onetoughnerd checking off the white board during today’s road …

2014-12-18: It may be a good thing no one is going anywhere anytime soon: Reps’ cars in parking lot are covered …

2014-12-18: Just uploaded photos from today’s roads press conference. There was a whiteboard & …

2014-12-18: Snyder showing off the new roads plan, ballot proposal. t.co/9P9cET7Hk…

2014-12-18: The whole Capitol press corps is waiting to get in for a press conference on roads deal. …

2014-12-17: Join @onetoughnerd, @jonathanoosting, @emilyjanelawler and other @MLive reporters for a live video …

2014-12-16: Sitting down with @MichiganGonzo for a Michigan’s Best live chat. Anything you want to know about …

2014-12-16: We can still hear the horns of the semi-truck protesters. They are protesting weight fee increases. …

2014-12-16: Is Lansing or a Maine harbor? Protest or Phillip Glass appreciation. Semi-trucks circle outside of …

2014-12-16: .@onetoughnerd will be joining @MLive tomorrow for a live video chat. What questions do you have for …

2014-12-16: Dear God… t.co/NezTU5HdD…

2014-12-15: Every time I get an @MLB app notification, my heart skips a beat wondering if something could be …

2014-12-14: Just posted a photo t.co/NTPvsQA7q…

2014-12-12: Sen. Claire McCaskill on @SenCarlLevin: “He understands the hazards of a misplaced …

2014-12-12: Levin says viral nature of news & info leads to less time to think, less thoughtful …

2014-12-12: Here’s a link: t.co/XOALkxiNL…

2014-12-12: Watching @SenCarlLevin’s goodbye speech on CSPAN

2014-12-11: .@chadmunce pitching @mlive and @MLiveMediaGroup at #LaunchedEvent t.co/RbYj48DM2…

2014-12-11: The @mlive_lansing crew is at #LaunchedEvent polling people about how they would start a business. …

2014-12-11: The @mlive_lansing crew is having a great time at the @ATHENAleaders lunch. Congrats to Dr. June …

2014-12-10: Idea: The music of Super Mario Bros. in the style of Buck Owens

2014-12-09: So it begins… @onetoughnerd for President? @CNN: t.co/bOL4jchzV…

2014-12-07: Row the Potato

2014-12-03: Just posted a photo t.co/1SbulwgLa…

2014-12-02: A Better Tomorrow

2014-11-30: The most bizarre thing: a long Ethernet cord hung from a tree near the river. @ Lansing River Walk …

2014-11-28: It was fun waiting for the new Star Wars trailer. Reminded me of 16 years ago, waiting for Ep. 1 to …

2014-11-28: Waiting (patiently) for new Star Wars Sixteen years ago around this time of year, I woke up early in the morning, turned on the computer …

2014-11-28: t.co/cynARq0ef…

2014-11-28: Star Wars. Refresh. Star Wars. Refresh.

2014-11-27: I am so excited about the new @starwars trailer. I am watching all the other ones tonight.

2014-11-27: What I’m still thankful for: the Kalamazoo Promise t.co/RmWmF4Kqd…

2014-11-27: Happy Thanksgiving everyone. This year @MLive is thanking WWII vetreans. Here is a tribute to those …

2014-11-27: Feeling fully thankful for the Kalamazoo Promise. Last week, I watched a documentary on CNN about college and student debt called Ivory Tower. While …

2014-11-26: That traffic jam was SO long I listened to an entire @atpfm episode

2014-11-26: No streetlights are on @downtownlansing — second time in the past few months where it’s been pitch …

2014-11-25: My #Homescreen: t.co/edhPUDaZc… t.co/6o9qCsJuB…

2014-11-25: Guess what this is @MichiganGonzo t.co/IrwpZoAIT…

2014-11-24: Wow — CNN crew tear gassed live. Nerve-wracking.

2014-11-24: Watching the split screen is surreal.

2014-11-24: Obama to make statement at 10 pm t.co/FxJpAs6ZM…

2014-11-24: I wonder what legalese there needs to be in a statement like this. Have never heard a grand jury …

2014-11-24: Watching as well

2014-11-24: Nice new home page, @MichiganRadio

2014-11-23: Did I just hibernate and sleep though winter? t.co/e5Ps1lKzC…

2014-11-22: 8-foot-high Lego model of Detroit’s Guardian building took 22 months to build …

2014-11-22: I always love when SIRI is proved wrong. #rtb t.co/zKg5xrUsv…

2014-11-21: Silver Bells in the City in a GIF t.co/amQiHFzV1…

2014-11-20: Watching the #ivorytower documentary on CNN — reaffirmed my love of liberal arts & how …

2014-11-20: Great to hear @sweetie_licious won Michigan’s Best pie! Great work from @MichiganGonzo @ToddChance …

2014-11-20: This is amazing. A man lives out of the same backpack I use every day. t.co/fq07CRQlH…

2014-11-18: When the first snowfall comes, all I want to listen to is Bjork

2014-11-18: Hacking… a toilet? If only I was 12 years old… t.co/FoP6nSv6L…

2014-11-17: I feel like this has been on every OS X update in recent years, but as an Exchange user, I’ll take …

2014-11-17: This NPR look at American street musicians includes a Lansing and MLive favorite… …

2014-11-16: I’ve taken a lot of steps in the past few months to become more of an adult; rinsing out bottles is …

2014-11-16: This is the first time I’ve made an effort to rinse out every bottle after drinking. The results are …

2014-11-16: As I stood waiting, I wondered: did they ever make a Lego Movie set of Emmet’s double decker couch?

2014-11-16: And I thought going while the Lions played would be a good idea.

2014-11-16: There’s a headline. RT: @MLive: Unconscious woman, 15 large snakes rescued from burning Portage home …

2014-11-16: Why would I ever think it’s a good idea to return bottles on a Sunday night in East Lansing?

2014-11-15: This has to be THE BEST license plate I have ever seen. The bomb. t.co/vyFAJQm7t…

2014-11-15: ROW ROW ROW THAT BOAT BRONCOS

2014-11-14: Snow top t.co/9sylICFG6…

2014-11-13: Honoring the Greatest Generation under the Capitol Dome t.co/5Pes4MuYP…

2014-11-13: The first veteran came at 8:30 this morning. Event starts at 11 t.co/pRW2n2b6H…

2014-11-12: Frandor is a mixture of parking lots and roads, impossible to distinguish. One of be worst places …

2014-11-12: Big day tomorrow t.co/XEl84RQYw…

2014-11-11: Is there any Leonard Cohen song that is not magical?

2014-11-11: I wrote a column today: Thinking of my grandpas on Veterans Day: t.co/owOvRhgZN… …

2014-11-11: Had a great time talking #mibest and journalism with @MIPAMSU and #mipams t.co/tXY257fIR…

2014-11-11: Getting ready to talk to 300 middle schoolers about digital journalism, storytelling and eating with …

2014-11-11: Is was fascinating to read these 30 historic World War II front pages from MLive newspapers …

2014-11-10: From the Upshot: The Places in America (and Michigan) Where College Football Means the Most …

2014-11-10: Now that the election is over, it’s looking more like Christmas in downtown Lansing …

2014-11-06: Election night pizza, 2 days later t.co/vIqEEKhCs…

2014-11-06: .@MichiganGonzo and @ZekeJennings are doing the hard work this #mibest for #mipie. Glad to help them …

2014-11-06: G.O.Pies. t.co/RMFH5yz0c…

2014-11-06: Is this where @sweetie_licious bakes all their pies? #bestpie #mibest t.co/y83xayNbJ…

2014-11-06: Pie time. #mibest #bestpie t.co/S6vRToRWc…

2014-11-06: Also, one of my favorite songs is called “Something to Talk About” by Badly Drawn Boy: …

2014-11-06: .@RepMikeRogers new radio show will start Jan 5, called “Something to Talk About” …

2014-11-05: I am so exhausted after covering the election that I continually tried to put a 30 pin iPhone …

2014-11-05: Terri Lynn Land received less votes for U.S. Senate than she did in her previous two statewide …

2014-11-05: And I saw this @TerriLLand sign on the back of a truck while driving back to Lansing …

2014-11-05: .@Peters4Michigan spoke w/ reporters today at same spot he kicked of campaign: spot where his …

2014-11-05: Six.ty. Votes.

2014-11-05: The GOP won 6⁄7 open U.S. Senate seats tonight — besides Michigan, where every other top …

2014-11-05: I’m sure there will be a recount RT: @emilymonacelli: O’Brien’s campaign declares …

2014-11-05: And in 2010, voter turnout was at 42.9 percent. Looks like 2014 will be down from that.

2014-11-05: We will see more and have a firmer idea in the morning when state has their numbers up.

2014-11-05: From latest AP results post, 2,882,787 people voted for Gov on Tuesday. That would put an estimated …

2014-11-05: Whenever I’m done for the night l

2014-11-05: NAIL BITER RT: @Alex_Mitchell67: McCann leads O’Brien by 135 votes with one precinct left to …

2014-11-05: Turnout looks like it was down from 2010 in Oakland and Kent counties. Waiting for more results… …

2014-11-05: But I’m staying up to watch the Michigan Senate race in Kalamazoo. What a nail biter.

2014-11-05: I’m done for the night, thanks for following along everyone.

2014-11-04: Schauer leaves to people chanting his name

2014-11-04: Schauer thanks crowd, leaves after 5 minute speech.

2014-11-04: Schauer: For me campaign is over, for all of us as democrats…this work must and will continue.

2014-11-04: Schauer: I learned one thing in this campaign: The people of Michigan never give up.

2014-11-04: Schauer: This was not about a campaign, it was a movement about the future of our state.

2014-11-04: Schauer said he spoke to Snyder on the phone. “I’m disappointed too.”

2014-11-04: Schauer: Tonight, when all the votes were counted, looks like we are going to come up a little …

2014-11-04: Schauer said he is proud of the campaign. Said he couldn’t have picked a better running mate than …

2014-11-04: Schauer: We went the distance with Rick Snyder

2014-11-04: Schauer: We worked hard, we put it all on the field. We made this race about our kids our seniors.

2014-11-04: Schauer: It’s been a long campaign, 17 months, 83 counties. 10s of thousands of miles on bumpy …

2014-11-04: Crowd is cheering his name. “Thank you all. You look beautiful. Like our best Michigan”

2014-11-04: Mark Schauer takes the stage

2014-11-04: Godfrey Dillard takes the stage for concession speech.

2014-11-04: Totten said he will fight for the same causes he advocated for on the campaign.

2014-11-04: Totten: “I am also just getting started. Winning an election and leadership are two different …

2014-11-04: Totten takes a hit at Schuette: this office is just not a way station on the path to running for …

2014-11-04: Totten, who ran to be the people’s lawyer, said justice just doesn’t happen. Most people walk away …

2014-11-04: Totten: “Tonight we came ups short, and I am profoundly disappointed…so much was at stake in this …

2014-11-04: Totten thankful for his kids ’Hope they got a glimpse in the long run for what it looks like to …

2014-11-04: Mark Totten takes the stage.

2014-11-04: It’s all Peters, Dingell and Lawrence right now. No word on MIGOV, if Schauer, Dillard or Totten …

2014-11-04: Media just had interviews with Peters. Still waiting on word for Governors race.

2014-11-04: Also, John Dingell is not here tonight.

2014-11-04: Debbie Dingell: I want to thank people who elected me, but also John Dingell and Carl Levin.

2014-11-04: Debbie Dingell: Carl Levin and John Dingell are 2 giants who served state for a long time. They’ve …

2014-11-04: Dingell said she is grateful for the people of the 12th congressional district. Thanking one person …

2014-11-04: Debbie Dingell speaking now. Tipper and Al Gore are my best friends…they projected that race …

2014-11-04: Detroit Regional Chamber sent out release congratulating Snyder

2014-11-04: I haven’t seen Dillard here tonight. Don’t know if he or Totten will speak. We’re waiting on Debbie …

2014-11-04: Lawrence said she’s going to Congress knowing “a pothole doesn’t have an R or D to it, it needs to …

2014-11-04: Here’s a photo of that sign I mentioned earlier. t.co/5HdFzJ24M…

2014-11-04: Brenda Lawrence on stage, who is taking Peters spot in Congress.

2014-11-04: Signs being held by Peters supporters. t.co/8XpUYyvSw…

2014-11-04: This election @Peters4Michigan said he learned “Everybody who works hard & plays by the …

2014-11-04: Peters said he will defend health care in the Senate

2014-11-04: Peters is touching on issues: equal pay for men and women, health care

2014-11-04: Peters said they are going to work to raise minimum wage to $10.10

2014-11-04: Peters said best experience of the campaign, travel state and meet with people, hear their stories. …

2014-11-04: Peters said he was able to counter money spent against him with volunteers.

2014-11-04: Peters is shouting out to campaign staff. “I have the best staff of any campaign in the country”

2014-11-04: Peters’ mother is here tonight. So our cousins, n laws, stage is filled with people.

2014-11-04: Peters said she is the one who stopped him from wearing those shoes with a hole in them.

2014-11-04: Peters thanking family on stage, first and foremost his “chief advisor”: wife Colleen.

2014-11-04: Peters said Schauer is in a tight race now. “We’re hoping he’s going to be our next governor”

2014-11-04: Peters said he thinks he and Stabenow will make a great team together

2014-11-04: Peter said Land called and conceded. He said she served state admirably as a public servant and will …

2014-11-04: Peters said he has been “always humbled by the prospect to repent the great state of ours”

2014-11-04: Peters on the stage t.co/IuoBOEcbi…

2014-11-04: Peters now talking: Levin represents the best of public service

2014-11-04: Peters on stage with family, hugging and kissing them. Looks over joyed

2014-11-04: Supporters holding sighs that say “Democrats Hustle Harder”

2014-11-04: Peters has taken the stage to the song “Happy”

2014-11-04: Proudest of tonight: is there is superb new member of Sen. Overflowing with pride.

2014-11-04: Levin said he’s proud to serve Michigan for 37 — proud too to be married for 50 years.

2014-11-04: Levin said he received a $10 bill that says “not to be used for buying elections” Levin said he’s …

2014-11-04: Stabenow introduces Levin. “Greatest gift the people of democracy can give to those of us who seek …

2014-11-04: Stabenow said the race wasn’t close in the beginning, but because of hard work Peters have a …

2014-11-04: Stabenow: “We know out next Sen will be Gary Peters” Crowd chants Gary - Gary

2014-11-04: Stabenow “even though folks are calling things, we have a gov race too close to call.”

2014-11-04: Stabenow some things we know now, some things we don’t: We have two new female members of congress: …

2014-11-04: Stabenow is on stage now: thanking Lon Johnson and volunteers

2014-11-04: .@MIGOP calling for Snyder

2014-11-04: Johnon said the party is also looking at votes in Flint and Lansing area

2014-11-04: Lon Johnson said it’s going to be a very long night. Doesn’t agree with @freep call on race. Said …

2014-11-04: It’s being stressed here that AP or MIGOP is not calling the Gov race… they are prepping for a long …

2014-11-04: Truth RT: @ChrisGautz: With as close as the polls have been in the gubernatorial race, it seems …

2014-11-04: And Debbie Dingell won, according to statement.

2014-11-04: People are starting to stand in front of the stage… expecting Peters to speak.

2014-11-04: People from Peters campaign walking around, getting hugs from supporters.

2014-11-04: Peters video is playing now? Will he speak?

2014-11-04: On Snyder race being called, folks at the Dem party are asking about Waybe county. Seem surprised …

2014-11-04: Land called to conceded to Peters

2014-11-04: My story: Gary Peters takes U.S. Senate seat in Michigan; trounces Terri Lynn Land …

2014-11-04: .@freep just called gov for Snyder?

2014-11-04: Nothing has really changed here in terms of the mood. Major networks are calling #MISEN, no music, …

2014-11-04: And everyone is calling it for Peters. No TVs on here at the Dem party. No cheering. Talking …

2014-11-04: With 6 percent in, Peters and Land remain at 54-42

2014-11-04: Here’s what I’m looking at in tonight’s election results: t.co/FV74ehDQC…

2014-11-04: Johnson said the weather was not preferable, but ”nothing to keep voters from voting.”

2014-11-04: When asked about Upton race in #MI06, Johnson said: “If Democrats turnout, there’s going to be …

2014-11-04: Lon Johnson said the party is looking for increased Dem turnout this election: Anything over 3.3 …

2014-11-04: 4 percent of precincts are in across: Peters has 54% and Land 42%. Also, polls are still open in …

2014-11-04: That 25% number may be low: 327 of 516 precincts are partially reporting and 132 of 516 are fully …

2014-11-04: In 2012, 662,842 people voted in Oakland. With 25 percent of precinct reporting now, the number is …

2014-11-04: Oakland County has 20.74 % of precincts reporting — Snyder is at 56.49% Schauer at 41.73%. Peters …

2014-11-04: Here are 20 races to watch tonight: t.co/R4tmDumgD…

2014-11-04: Just talked to @stabenow — even though polls just closed, she said Peters earned this victory …

2014-11-04: Michigan’s soon to be Sr. Sen Debbie @stabenow t.co/BOGRpRMG6…

2014-11-04: Terri Lynn Land spoke with reporters earlier tonight, said the race has always been close but said …

2014-11-04: Polls closed in most of Michigan (besides counties bordering Wisconsin). Let the counting begin….

2014-11-04: 10 minutes…

2014-11-04: Here’s Whitmer talking with media. t.co/hNWQSji2l…

2014-11-04: Whittier didn’t say what’s next for her after December when she’s term-limited out, goal is to grow …

2014-11-04: Talked to Gretchen Whitmer: she said this feels more like a prez year 4 turnout. ppl are seeing how …

2014-11-04: Amazing to think polls close in 50 minutes.

2014-11-04: The place for victory or concession speeches. At the Dems party t.co/qOBq68Cdu…

2014-11-04: Just arrived at the @MichiganDems party at the MGM Grand in Detroit. Media is setting up …

2014-11-04: They said it happens all the time and were able to switch it

2014-11-04: Got a hotel room for covering the Dems party tonight. Only problem: booked for the MGM Grand in …

2014-11-04: Talk about a November surprise. t.co/mpsFVaqVF…

2014-11-04: Yes. That’s Christmas music playing downtown Lansing. Get Out the Sleigh Bells …

2014-11-04: Heading to Detroit for election coverage tonight.

2014-11-04: In non election news: I left my trunk open while getting other bags and came back to see a cat …

2014-11-04: And the only mention of Michigan in Politico’s Playbook? A reference to the John Oliver segment on …

2014-11-04: Voter 87 Lansing Ward 4 Precinct 39 9:18 am t.co/kjq0EdAHH…

2014-11-04: Today isn’t the first time @TerriLLand and @Peters4Michigan appeared on a ballot together. In …

2014-11-04: Time to check off the most important task of the day t.co/r2d2ogfas…

2014-11-04: The only references to Michigan in this morning’s @politico huddle? The times polls close and a …

2014-11-04: There are 4,833 precincts open and 7,446,280 registered voters in Michigan today, per the @MichSOS …

2014-11-04: Polls are open in the Great Lakes State. For the next 13 hours, voters will decide Governor, next US …

2014-11-03: And there will be 148 elections deciding the legislature tomorrow – forgot to add in the …

2014-11-03: Election eve. Calm scene outside Capitol & Romney bldg. Tomorrow 110 elections will decide …

2014-11-03: Just watched this John Oliver video on State Legislatures. Are there any “windowless committee …

2014-11-03: Polls open in 13 hours. Have you decided how you are going to vote? Here’s some help: …

2014-11-03: A forewarning for my Twitter followers: There’s going to be a lot of election tweets in the next 48 …

2014-11-03: Oh. Yeah. Alan Trammell returns to Detroit Tigers as special assistant to general manager Dave …

2014-11-03: Here’s 5 Michigan congressional races I’ll be watching tomorrow night: t.co/EfmZm6Wjb…

2014-11-03: It’s pretty amazing to see these campaigns in the final hours after they’ve been working for months.

2014-11-03: In the lobby of the mechanic and it’s all political ads on the TV. Seriously.

2014-11-02: Democrats rallying on MSU next to Sparty t.co/AaCH4hmL1…

2014-11-02: But still made it RT: @jonathanoosting: Speed bump on the campaign trail. t.co/MGJoOcUyg…

2014-11-02: Hello Mt Pleasant. t.co/CrUEfpN0M…

2014-11-02: Gov Blair’s view will be blocked for the next few months @ Michigan State Capitol …

2014-11-02: I really hope this truck is named “Vote” – it would bring a whole new meaning to …

2014-11-02: That extra hour of sleep was rejuvenating.

2014-11-01: The Clintons, Obamas, Mark Schauer and Gary Peters holding hands at rallies this election …

2014-11-01: Fascinating to see shots of crowd on live stream

2014-11-01: Is there a live stream of the @MichiganDems Obama event?

2014-11-01: So begins the final days of the election: @MIGOP kicks off 17-stop bus tour t.co/2IYyYA9Uh…

2014-11-01: The State Christmas Tree is here! t.co/RxsErUKlB…

2014-11-01: Just wrapped up the @MIGOP bus tour kick off. t.co/n8YcA0VOa…

2014-11-01: As we are waiting for the @MIGOP to kick off their statewide bus tour, the state Christmas tree …

2014-11-01: And I only have white tape t.co/hr8rLWn3Z…

2014-11-01: Nothing like waking up to cover an event, grabbing your glasses and having them break …

2014-11-01: lesson learned: don’t dress up for Halloween as a medication you are currently taking.

2014-10-31: I think I made the nastiest drink. t.co/vnO9xOfhK…

2014-10-31: When your whole life is in @OmniFocus… t.co/ONyUpwj4e…

2014-10-31: What’s more frustrating than working on a hard drive that keeps crashing… not using …

2014-10-30: The saga continues… t.co/lc94oV8vR…

2014-10-30: Oh hey – this isn’t something you want to see 5 days before an election …

2014-10-30: I think I’ve just had the best chicken I’ve ever tasted. t.co/K0wLCbRvb…

2014-10-30: Posters posted downtown Lansing, with Info Wars logo. t.co/FEcyv8Nxc…

2014-10-29: I can’t imagine what it’s like in KC now — the crowd was so hyped…

2014-10-29: Great season from the Royals, they really pulled through. And congrats to the Giants.

2014-10-29: Hold on KC, you got this.

2014-10-29: It’s #nationalcatday Here’s what I say to felines. “you’re cute, but I’m really allergic.”

2014-10-29: I’ve received a few SMS notification on my Mac before they appeared on my iPhone. Kinda c razy

2014-10-28: Coming tomorrow… @ Tavern on the Square (Downtown Lansing) t.co/9Z9HkzIkR…

2014-10-28: Forgot to mention: counties in the UP that border Wisconsin are in the central time zone. So add 60 …

2014-10-28: 604,800 seconds… 10,080 minutes… 168 hours… 7 days… 1 week… until …

2014-10-28: Glass Wrangler: 1920s: “Broken Glass Department” t.co/XYNxjiwB3…

2014-10-28: Training my taste buds @MichiganGonzo t.co/T5YfbXsYE…

2014-10-28: These are amazing mock ups of redesigned American money t.co/rrAztMl3K… …

2014-10-28: Have you ever worn a Michigan-related Halloween costume? #puremichigan t.co/3DCJw6wsO…

2014-10-28: This is big: “Pope Francis declares evolution & Big Bang theory are right, God …

2014-10-28: U.S. senator and Metropolis governor? Debbie @Stabenow talks role in Batman vs Superman …

2014-10-28: If you would have told me this morning I would be writing a story about @stabenow, Batman and …

2014-10-28: Where’s the best place to get pie in the Lansing area? #mibest #bestpie t.co/31MQimQK7…

2014-10-27: I think for #mibest #bestpie we need to rewrite “Little Jack Horner” for @MichiganGonzo …

2014-10-27: Detroit Mass Mob fills pews in struggling churches t.co/67FbQiiZy…

2014-10-27: From the WSJ on Detroit: Why Are These People Pedaling? To Make Beer, of Course …

2014-10-27: If you need a laugh today… t.co/IwXHLVfrP…

2014-10-27: For the next Michigan’s Best search… t.co/vsKqqZvRt… #mibest #bestpie …

2014-10-25: I’ve seen houses moved, but a 350 ton tree? It’s happening today at University of …

2014-10-25: Have any questions about the upcoming election? Here is everything you need to know for Nov. 4 …

2014-10-24: For the first time in a long time I’m starting the weekend without any alert badges on apps. …

2014-10-24: hate seeing what’s happening now. horrible, horrible, horrible. prayers with everyone there

2014-10-24: ugh

2014-10-24: Great to be back (@ Kalamazoo Gazette Media Hub - @kzoo_gazette in Kalamazoo, MI) …

2014-10-24: Disclosures on the U.S. Senate disclosures. t.co/DhRR7MqgP…

2014-10-23: What color do you get when you combine @umich blue and @michiganstateu green? t.co/19WjmK5P9…

2014-10-23: ’Tis the season: Massive blue spruce to make 430-mile journey to become Michigan Capitol Christmas …

2014-10-23: Seasons change t.co/Dza5wGR4c…

2014-10-22: This ad is targeting me correctly. #rtb #wmuhomecoming t.co/paWRqw0nU…

2014-10-22: Front page of NPR this morning: The 2014 Campaign Ads That You Just Can’t Stop Replaying …

2014-10-22: From the Upshot: How to Win the Senate: The States Each Party Needs. Michigan is not included for …

2014-10-21: Rock the news headlines t.co/Dff2niIeM… t.co/sGQS0xpl0…

2014-10-21: .@TerriLLand says campaign raised $2.13 million in 3rd quarter — but doesn’t say if she donated any …

2014-10-21: Talk of the office: Why is there a severe lack of good doughnut places in Lansing?

2014-10-21: NPR: What Ferguson, Mo., Could Learn From A Small Michigan Town t.co/Cb2CeOSql…

2014-10-21: From the WSJ: In Fred Upton’s District, Big Money Makes an Appearance t.co/0XGSiVRd0…

2014-10-20: Command+Shift+/ is my new BFF

2014-10-20: It’s rough in the @mlive_lansing office: E-mail is down and there’s a thousand of #fallMIPA students …

2014-10-20: They changed the volume level noises in OS X 10.10!!!!!

2014-10-20: Had a great time speaking about using my smartphone as a journalist during #fallMIPA — here are …

2014-10-20: Great historic photo of Kewpee Hamburgs from the 1930s… maybe I will go there for lunch? …

2014-10-20: Looking forward to talking about smartphone journalism this morning to students at #fallMIPA

2014-10-20: That’s not my name t.co/taD1DHqsj…

2014-10-19: For some reason, I feel like OS X 10.10 has made my screen larger. For some reason, the new design …

2014-10-19: Found my Halloween costume, @MichiganGonzo t.co/KhbFHqVL0…

2014-10-17: The @Kzoo_Gazette is hoisting a fascinating interview right now with @RepFredUpton about @MAYDAYUS …

2014-10-17: Could this be the coolest poster in a waiting room? t.co/HQZEBYym4…

2014-10-16: Hey, nice shout out to @TechSmith during Apple’s iPad keynote.

2014-10-15: My mind is being blown right now #HowWeGotToNowPBS

2014-10-15: Turned on CSPAN after watching #mitownhall and see the #KYSEN debate. Really interesting watching a …

2014-10-15: Quid agis mane, O Troia. t.co/0xGuUaPvp…

2014-10-15: Look at that digital device t.co/PJEcqOM4h…

2014-10-14: Final #ballotbash t.co/kDkJYSX4l…

2014-10-12: From a visual standpoint, one thing I love about debates the most is that you get photos of the …

2014-10-12: #MiTownHall in a gif t.co/hbNA6YbAJ…

2014-10-12: I am enjoying this music before #mitownhall, but it’s no intro music for @MichiganRadio’s …

2014-10-12: Which hashtag to use? #midebate or #mitownhall — or both?

2014-10-12: My colleague @jonathanoosting is covering the debate in person. I’m here in Lansing watching …

2014-10-12: #mitownhall may be the only debate in Michigan for any statewide candidates this election. This is …

2014-10-12: Just found out the #mitownhall will be on CSPAN — pretty neat.

2014-10-12: I don’t know why – with the advancements in technology – there are still storage limits for …

2014-10-11: Having a beer at @GonzosBiggDogg – great stuff. Not the same as having a beer with …

2014-10-11: #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB #RTB …

2014-10-11: Looks like some changes are coming to downtown Lansing… t.co/iFxMIZfFb…

2014-10-10: What a great post from one of my favorite artists @Sam__Phillips t.co/870JGqIVK…

2014-10-10: Full #ballotbash video interviews by @MLive and @jeneyer of @MarkSchauer and @Godfrey_Dillard …

2014-10-09: This is what happens when you paint in the fall @ Michigan State Capitol t.co/rgN8U5id1…

2014-10-09: Ready for a party tonight at #ballotbash t.co/fH4oQQelH…

2014-10-08: .@wxyzdetroit says that #MISEN debate negotiations have ended: t.co/EOwHoP6Ka…

2014-10-07: I need more bags. #BallotBash t.co/IWEkpaLT9…

2014-10-07: This could be huge: Asian carp DNA detected in Kalamazoo River, which flows into Lake Michigan …

2014-10-07: Here are full @MLive #BallotBash interviews with @SchuetteOnDuty @RickForMI @TerriLLand @RJ4MI …

2014-10-07: Last night, @Mlive had it’s first #BallotBash. Full videos of interviews are coming soon, but here …

2014-10-06: Streaming live now: @mlive’s #BallotBash t.co/ACKeMck2V… t.co/Fa8Lba78k…

2014-10-05: Let’s get it started Tigers! @ Comerica Park t.co/fpRyM8Mfw…

2014-10-03: I really liked that intro music for #micalling — think it may be my new alarm music

2014-10-03: Did the #micalling stream cut out for anyone? Was about to begin and top of the our news started. …

2014-10-02: A loss is a loss.

2014-10-02: It’s so bad, Miggy is not talking

2014-10-02: BACK TO BACK

2014-10-02: My story from @MittRomney visiting Michigan, with photos from @jakemayphoto t.co/VAGcdUwBl… …

2014-10-02: Now Romney meeting the crowd, shaking hands, holding babies, and people are taking selfies

2014-10-02: She has also talked about the “war on women,” road funding and repealing the ACA

2014-10-02: Land said she is not in favor of amnesty for immigrants, but securing the boarder.

2014-10-02: Romney made no mention of Rick Snyder. The only Michigan Governor he mentioned was his own father

2014-10-02: Romney introduced Land. Now she is on the stage speaking

2014-10-02: . @MittRomney with Michigan GOP candidates t.co/ODVoXiv2w…

2014-10-02: Romney said every time he comes back to Michigan, he learns more about his mom and dad. Met woman …

2014-10-02: This crowd is hyped about Romney. Really hyped. Don’t know if other former U.S. Presidential …

2014-10-02: Ronna Romney McDaniel “Boy, am I glad to have uncle Mitt here today”

2014-10-02: And we are back. I think Mitt Romney is on stage but can’t see because every is standing up….

2014-10-02: In other news: The Atlantic will host a town hall with U.S. Rep. John Dingell and former Rep. Peter …

2014-10-02: Well, there’s an intermission. And we’re taking a break before Romney, apparently will go on stage.

2014-10-02: Ron Weiser, running for UofM Regent, said despite the issues at the school now, it remains one of …

2014-10-02: We are 40 minutes in to the event and we are hearing from all parts of the Michigan GOP ticket

2014-10-02: Now Dave Trott takes the stage. Lots of people behind him, don’t see Terri Lynn Land or Brian Calley …

2014-10-02: Also, Schuette copares the “all star” GOP team to the Detroit Tigers

2014-10-02: Schuette praising party chair: In the next 33 days, we are going to have a lot of B.S. out there, …

2014-10-02: .@SchuetteOnDuty hypes up the crowd: Are you on duty?

2014-10-02: Ruth Johnson on 2014 election: This is one of the most important times of our lives.

2014-10-02: After a pledge, prayer, we are on to Ruth Johnson speaking.

2014-10-02: Michigan GOP Chair Bobby Schostak and candidates take the stage. “We have become America’s come back …

2014-10-02: And now people are here t.co/4oeXGk3mm…

2014-10-02: One of the biggest questions I have about @MittRomney’s appearance today: will he take the stage to …

2014-10-02: The U.S. Senate race, summed up in yard signs. t.co/11G1I7NEX…

2014-10-02: I’m here waiting for the candidates, and audience, to enter t.co/TsrC2Wk1T…

2014-10-02: Heading to Livonia to a rally with @MittRomney and @MIGOP – also the protest outside

2014-09-30: You can watch the candidate forum here: t.co/VfQv70och…

2014-09-30: In Brighton for a candidate forum featuring @EricSchertzing and @MikeBishopMI. First, judicial …

2014-09-30: Yes: FCC kills sports blackout rule t.co/4S9qik96C…

2014-09-28: Yes!!!!!

2014-09-27: I’ve never been to a bar where they’ve told me to take off my hat. It’s a Tigers hat and the game is …

2014-09-27: So 50 Cent’s “P.I.M.P.” is on and Siri heard this t.co/vSv07LoRf…

2014-09-26: RIP to Zoom.it t.co/CeGfD8JgW…

2014-09-26: Foggy morning. @ Michigan State Capitol t.co/qVLTERl4q…

2014-09-25: It looks like Jeter is trying not to get emotion right now

2014-09-25: Fall t.co/mvhqYS3fq…

2014-09-25: Good morning Lansing t.co/csoQJ1vYn…

2014-09-25: t.co/NyRXCE1sO… t.co/dTaC7MfcP…

2014-09-24: Going shoe shopping. t.co/lAhqG0eCq…

2014-09-24: Looking forward to trying the new @Circa news app. Always loved how they approach news on …

2014-09-23: Miggy!!!!

2014-09-23: That look of relief and David Price’s face after that catch….

2014-09-23: This is the perfect fall night for watching baseball

2014-09-23: Pretty generic headline on front of White House homepage. t.co/wIy80Gj7h…

2014-09-23: The War Govenor t.co/2vg723WGX…

2014-09-22: Spent the night making a spreadsheet to track the Tigers and Royals battle for the playoffs. Yes, …

2014-09-22: Now is the hardest question: who do I like more: Dan and Jim or Mario and Rod?

2014-09-22: Wait — and you can also have the radio overlay?! This is exactly what my grandpa did.

2014-09-22: Just discovered on @MLBTV you can switch the audio to the ballpark feed. No commentators. Sounds …

2014-09-22: The crowd does look like it would be during a major storm

2014-09-22: OK, I don’t think there would be fireworks for an Indians win during a “home” Royals game.

2014-09-22: There must be no better way to start off a baseball game.

2014-09-22: This game being resumed in the bottom of the 10th is so ridiculous I can’t stop giggling.

2014-09-22: Also, the @indians schedule looks crazy. An away game immediacy followed by a home game. …

2014-09-22: Really excited to see this 10th inning finish up with @Indians and @Royals. This could be a nice …

2014-09-22: OK, here’s a story from Detroit News: t.co/jjcqsjOJ6…

2014-09-22: So the Schauer campaign is calling it a debate, Snyder campaign calling it part of his Road to …

2014-09-22: Wait, and there’s going to be a debate between @onetoughnerd and @MarkSchauer? Per @freep: …

2014-09-22: After trying them all, I finally found a streaming music service I liked. Now it looks like Beats …

2014-09-22: If you’ve updated to iOS 8, make sure to set up your Medical ID. If you use another phone OS, …

2014-09-22: I’m feeling better after four days of being sick. On the bright side, I finally viewed “The …

2014-09-21: Having Instapaper and Pinboard extensions inside apps like the New York Times is amazing. Changes …

2014-09-21: The new Leonard Cohen album “Popular Problems” is streaming. It’s excellent. Well worth a listen on …

2014-09-20: Really, you could row a boat at the Big House tonight

2014-09-20: Wow, what an end.

2014-09-20: Does Don Kelly pitch?

2014-09-20: I took the case off my iPhone. Then I dropped it on a plate. iPhone wins t.co/XGrlSzSZ4…

2014-09-20: I am on Day 3 of being sick. Let’s hope it’s the last

2014-09-19: Apple’s new predictive keyboard. Is this Dre’s influence? t.co/VUlwi1uhc…

2014-09-19: They’re out there: just someone saw someone walking down the street with a gold iPhone 6. Could tell …

2014-09-19: This week I got to see Enbridge and EPA have an oil spill drill. t.co/6l1CnNSZF… …

2014-09-19: The Church of U2 t.co/kpkQq97MY…

2014-09-18: Elections would be a lot more fun if county clerks announced the results when votes were counted.

2014-09-18: What’s that in the lower left hand corner of my iPhone? Nice iOS 8 update, @meijer …

2014-09-17: I’m on Indian River today for an oil spill drill with Enbridge, EPA US Coast Guard and other …

2014-09-16: Don’t know if I’ve been so excited about new software as iOS 8 & @TextExpander …

2014-09-16: This hotel is the best. Look at this desk! t.co/k1lDCKjCd…

2014-09-15: Tough call for me tonight at 8pm – watch the @tigers or #RooseveltsPBS? @john_dingell I need …

2014-09-14: This may be the best thing I’ve seen on the Tigers scoreboard. Jeff Daniels as Harry pumping …

2014-09-14: The Capitol t.co/HZAsWmK5A…

2014-09-14: His pleas got some kind of outs

2014-09-14: There’s a little kid who is pleading with Nathan to strike someone out. Pleading. We are too.

2014-09-13: Had to stop by for a pint on #mibestbar (@ O’Duffy’s Pub in Kalamazoo, MI) …

2014-09-12: Setting up at Beerfest and the Ballpark t.co/NhMGD57TR…

2014-09-12: Tonight is the Beerfest in Ballpark. Here’s a photo from the one earlier this year …

2014-09-11: It’s night and the street lights are not on @downtownlansing t.co/x5wrzbcyz…

2014-09-11: As the bartender said, they brought out the good China tonight. #mibestbar t.co/wNGzp6Ym1…

2014-09-11: First shot of the #mibestbar. This is the Chior at the Peanut Barrel. @ The Peanut Barrel …

2014-09-11: Helping @MichiganGonzo and @JessShepSaginaw kick off #mibestbar t.co/McW2QeGeO…

2014-09-11: Flags are at half staff today to honor the men and women who died on 9⁄11 …

2014-09-11: Michigan members of Congress praise, question Obama’s plan for airstrikes @justinamash …

2014-09-10: Had fixed feelings about the new U2 album yesterday… Today like it a lot more. Some solid …

2014-09-10: Or that! What an icon t.co/5Y9tdRQJN…

2014-09-10: Woah, never thought I’d see this t.co/BsxNExn59…

2014-09-10: Hate it when you plug in headphones, have a bunch of tabs open, one has an auto-play video running …

2014-09-09: Petoskey stone. RT: @petesouza: Instagram from today: on the President’s desk t.co/d1Y1PPwMM…

2014-09-09: It’s been a treat working on the Michigan Honors project this year. Here are more profiles of …

2014-09-09: t.co/fEOSmBtqF…

2014-09-09: Kinda more excited about the new U2 album, and am franticly trying to find where I can find it

2014-09-09: Wow. A new U2 album too. Wow.

2014-09-09: Long live the live blogs!

2014-09-09: It’s like the good ole’ days! RT: @drdrang: Back to reading liveblogs.

2014-09-09: OK, time to turn Twitter off for a bit. See ya later

2014-09-09: I think it’s interesting that Apple is live blogging this event, and that they are using a hastag

2014-09-09: 19% of Michiganders think the @Tigers win the World Series, according to PPP. 25% think they win the …

2014-09-09: Who has a 48% approval rating in Michigan? Brad Ausmus, according to PPP poll. 39% are not sure, 13% …

2014-09-09: Looking forward to today’s Apple event, but I may shield myself from the news until I can …

2014-09-09: With empty chair representing @TerriLLand, @Peters4Michigan calls for debates in #misen …

2014-09-09: On Apple events [caption id=“attachment_883” align=“aligncenter” width=“620”] …

2014-09-09: Taylor Swift studied Latin t.co/obrXPrJA0…

2014-09-08: As soon as Peters began talking about getting out the vote in Nov & how Michigan has low …

2014-09-08: Peters cont.: “The U.S. Senate is where, to do the job, you also have to stand on your feat, you …

2014-09-08: Peters: “This is not the ideal format – the ideal format would have been a debate.”

2014-09-08: In GR for “empty chair debate” @Peters4Michigan is hosting in response to no debates …

2014-09-08: Nothing better than driving down the highway, listening to the @tigers on the radio, hearing them …

2014-09-08: Had to pull into a rest stop to tweet: what am amazing inning for the @tigers! 8 hits?!??

2014-09-08: Could the @tigers going to the postseason impact #misen? @RollCall takes a look at media buys and …

2014-09-08: .@john_dingell has been admitted to Henry Ford Hospital with abdominal pain. Office says he is …

2014-09-08: It’s not fall yet.@MLive is looking for your favorite summer memories of 2014. Submit them here: …

2014-09-07: “Harbor Springs: 1906” t.co/xfeybyBm8…

2014-09-07: Jordan to Jeter: “Now it’s time to get married”

2014-09-07: This tribute to Jeter is great

2014-09-06: Had a great, impromptu visit to Detroit today. @ The Majestic t.co/BqjGSA9WY…

2014-09-06: .@Sophie_and_Lucy!!! What happened? @tinynotebook @FKA_viD t.co/u4h5bopmP…

2014-09-06: “One Way or Another” being played during a review – well played Comerica Park

2014-09-06: This is a great matchup. t.co/rKKW1isP2…

2014-09-05: Thank you for switching to this. t.co/Mcx0Vlayq…

2014-09-05: Rain delay in the Tigers-Giants game? Show highlights no one wants to see. t.co/McDzD4YYo…

2014-09-05: Storms in Lansing t.co/ojNRkaKmf…

2014-09-03: I stop at Starbucks in Mt Pleasant and look who is greeting me at the milk-sugar table, @grahamdavis …

2014-09-03: Looking at the pipeline t.co/nK4oVdwHk…

2014-09-02: WOOD-TV postpones governor, senate debates as Rick Snyder, Terri Lynn Land fail to agree #misen …

2014-09-01: Best gas station ever? @amyonthetrail @MichiganGonzo t.co/B6XkAzuaj…

2014-09-01: That was nice of Victor, hitting a homer so Miggy doesn’t have to play the bases.

2014-09-01: A few jet planes flew over Progressive Field at the beginning of the game. It was really loud. How …

2014-09-01: So I forgot my bag of clothes when I came to Cleveland for the weekend. Glad my parents had …

2014-09-01: Found this at my parents house. From my first baseball game. t.co/ox4H2BtFe…

2014-09-01: Heading to Progressive Field for the @tigers and @Indians game. See a cloud of black smoke in the …

2014-08-30: "Don't dismiss the humanities" To adapt to a changing world, we need new software for our cellphones; we also need new ideas. The …

2014-08-29: Awesome to see @regoapp has been updated. One of my favorites for keeping track of places I’ve …

2014-08-28: One of my favorite views in Lansing. @ Waterfront Bar and Grill t.co/fCu5Ok9nN…

2014-08-28: What could the 33.33 mean? t.co/Ggnpb6Q8w…

2014-08-28: Nothing like hearing Alec Baldwin’s Glengarry Glen Ross during a salsa training.

2014-08-27: 1tb for $9.99 a month?! Dropbox is changing the game. Could change how I backup photos. …

2014-08-27: It’s great to see one of my favorite apps, @quotebookapp, has been updated. I use it to collect and …

2014-08-27: I have a morning routine of checking e-mail and organizing tasks that takes about 20-30 minutes. …

2014-08-26: Playing around with Hyperlapse on the Greyhound. Smooth. Wish I had it on the flight last night. …

2014-08-26: Was it a joke? Samsung Galaxy S5 charging station did not let me be a 'wall hugger' [caption id=“attachment_869” align=“aligncenter” width=“620”] …

2014-08-25: And I’m off! Had a great time in San Francisco. t.co/beoP4sO8l…

2014-08-25: Today’s front pages in San Francisco. t.co/RJPOwZMHC…

2014-08-24: First In-N-Out Burger experience. t.co/NOPsNQ56l…

2014-08-24: They are amazing. Need some soon. RT: @MichiganGonzo: Love me some @gowesco doughnuts! Right …

2014-08-23: What a great boutonniere #jakeandmel2014 @ Fay Park t.co/kCeCCL9u1…

2014-08-20: Nice shirt, San Fran. Anyone have an idea what the 72 is for? t.co/mfxdayGsd…

2014-08-20: It makes me so happy that Leonard Cohen keeps making music. t.co/zEw8zyO3T…

2014-08-19: So I walked a lot today t.co/5DLI8OStV…

2014-08-19: Enjoying the second most beautiful bridge in the world. @ Golden Gate Bridge t.co/518r1LsV5…

2014-08-19: Hello San Francisco!

2014-08-18: On vacation this week and am only checking my personal email. That means no Outlook. Anyone have any …

2014-08-18: Jet airliner. t.co/WnWC80Oco…

2014-08-18: Technology replacing glasses? This could be amazing. Clive Cookson for the Financial Times: The technology, being developed at …

2014-08-18: Glad to be traveling cross country today – enough time to check out the new @_RelayFM …

2014-08-18: I am! t.co/r2UcpaQgU…

2014-08-18: t.co/4duH6oVQR…

2014-08-17: Watching these streams really brings coverage to a new level. I’ve seen ppl live stream …

2014-08-17: It is frightening to see the live feed from Ferguson

2014-08-16: What a traffic jam on I-96. 10 miles in 80 minutes. No apparent crash, lane closure. It’s ok. …

2014-08-16: Salsa creation. @ Holland Farmers Market t.co/VnkUwaQoJ…

2014-08-16: In @DowntownHolland today to judge the Salsa Showdown. Let’s see how it compares to #mibest …

2014-08-15: Just got the best push notification ever. t.co/1Bpo2CmDN…

2014-08-15: The Mid-Michigan chapter of the 82nd Airborne Division Association is at the Capitol for National …

2014-08-15: It feels great to be typing words again on Twitter with @ylichterman after out emoji experiment. A …

2014-08-14: 💤💤💤

2014-08-14: 🌟🍳“@ChrisGautz

2014-08-14: ⚾️ 🔥🐶 🍎🍰 🚘

2014-08-14: ⚾️ t.co/VULCfC4eI…

2014-08-14: 👏🌰 @LansingLugnuts t.co/4tZmhR3J0…

2014-08-14: 🚴➡️💵💵💵 @MichiganDOT 📊💬 📰 t.co/W2yOuttQb…

2014-08-14: 🌲🏃🏭📱 t.co/eacQAVtim…

2014-08-14: ❓👆 @john_dingell , @ylichterman

2014-08-14: 🚲🚴🚵💰💰💰➡️✋ 🔜📰

2014-08-14: 🐅⚾️👋😳 📰➡️ @jamesschmehl t.co/8Dtcw2kez…

2014-08-14: ❄️❄️❄️❄️❄️❄️❄️❄️❄️❄️ ️❄️❄️️❄️❄️️❄️❄️️❄️❄️❄️❄️ ❄️❄️🏡❄️❄️❄️❄️🏢❄️❄️ 📰➡️ @weathermanmark …

2014-08-14: .@MLive 👈👍👊

2014-08-14: 🍔🕧

2014-08-14: ✌️📆 @ylichterman 🚫🔠 👍😄👍🌌 👍🎡💨 👍🔗 t.co/Al5Z46u9g…

2014-08-14: 🌊✋❓🚿🚨 📰➡️ @emilyjanelawler t.co/wBBUwFxsv…

2014-08-14: 👌🌇🐣 t.co/MGXDaO40E…

2014-08-13: For the next 24 hours, @ylichterman and I will tweet only in emoji. We will also use photos, GIFs …

2014-08-13: Wow. Just catching up with everything that happened tonight in #Ferguson

2014-08-13: I will speak in pictures not in words So I don’t know exactly what will happen tomorrow or how I will express myself. Tomorrow, …

2014-08-12: 5 ways I track news on my iPhone t.co/im9KrE2Wj…

2014-08-12: .@john_dingell It’s an experiment, @ylichterman and I are trying, would you like to join❓

2014-08-12: 5 ways I track news on my iPhone I spoke last week to more than 300 high school journalism students about how I use my iPhone as a …

2014-08-12: From Politico: Koch-linked group cancels Michigan ads t.co/dBqMUKgBk…

2014-08-12: Michigan State Police helicopter takes off with Gov Snyder t.co/COLzy19Wu…

2014-08-12: Snyder just held a short press conference with Capitol media before taking to the sky to assess …

2014-08-12: Waiting for a press conference with @onetoughnerd on Detroit water flooding. t.co/oOXvVGVZj…

2014-08-12: From the New York Time, on a topic dear to my heart: With 4 Retirements, Michigan Will Lose …

2014-08-11: Statement from President Obama on Robin Williams’ passing t.co/keS1wgW03…

2014-08-11: Going through the list of films, I forgot how many roles I loved: Toys, What Dreams May Come, …

2014-08-11: A personal favorite role Williams player was in “Hook” — a grown up Peter Pan

2014-08-11: It’s amazing to look back on Williams’ career and all of the roles he played. So many childhood …

2014-08-11: Williams grew up in Bloomfield Hills and attended Detroit County Day School.

2014-08-11: Wow, sad to hear about Robin Williams passing. Wow.

2014-08-11: A young @tinynotebook? RT @Shorpy: June 1929. “Young boy with bucket and pole on the …

2014-08-11: Head over to the @BayCityTimes for the latest on the potential water storage. Crews are still …

2014-08-10: Just a summer night in Lansing. @ Michigan State Capitol t.co/Ff3Ee3mDd…

2014-08-10: That @tigers game was so long (397 minutes) you could have watched the original @starwars trilogy …

2014-08-10: What if all baseball games were this long?

2014-08-10: This Tigers game is so long my Mom said she had both lunch and dinner during it. My dad took a nap …

2014-08-10: With this Tigers game, I’d say golf is more interesting

2014-08-10: I’ve been waiting for 60 Minutes but have started to enjoying watching the PGA Championship. …

2014-08-10: And if we are having issues near the Great Lakes, I wonder what it is like for communities in the …

2014-08-10: With Toledo last weekend and Bay City this weekend, it’s amazing to think entire cities can be …

2014-08-10: #curiosity t.co/XKCU46NEt…

2014-08-10: Give me steam t.co/FTru8pKIU…

2014-08-10: Water emergency: Bay City could be out of water by Monday if crews can’t find broken water …

2014-08-09: RT: @LindsayVanHulle: The line outside #Lansing’s new Apple is about 100+ long a half hour …

2014-08-08: People at bars are taking Star Wars spoilers. Supposedly. 🙉🙉🙉🙉

2014-08-08: Pope Francis urges young people not to waste time on Internet: “Our life is made up of time…” …

2014-08-07: It’s always a good day when you have to watch part of the Colbert Report for a story.

2014-08-07: That moment when you are ready to dial in to a press call and you realize you needed to RSVP… …

2014-08-06: Whaaaaaaat? t.co/NxpgzySvb…

2014-08-06: And now it’s time for some sleep. Goodnight #miprimary

2014-08-06: And it looks like, according to numbers right now, turnout was 17.4 percent t.co/hlUC0MW1V…

2014-08-06: If you count everyone who voted for Prop 1, via the AP numbers, turnout is around 16.5%. Could be …

2014-08-05: Eric Schertzing wins 8th Congressional Democratic primary t.co/NRrHvRXJn…

2014-08-05: Will the Tigers keep going until all the results are in?

2014-08-05: RT: @PAWSDetroit: #LETSGOTIGERS!!

2014-08-05: MI08 still close, with 85 percent in: Eric Schertzing 40 percent Susan Grettenberger 38 percent

2014-08-05: RT: @MIRSnews: MIRS Call: @JohnMoolenaar will defeat Paul Mitchell in 4th Congressional Republican …

2014-08-05: In MI08 with 78% in: Schertzing: 40% Grettenberger: 39% Darga: 11% Hank: 10%

2014-08-05: Results are all not in…and the Tigers go to extra innings!

2014-08-05: With 29 percent in, Prop 1 wins 69-31

2014-08-05: AP just called victory for Prop 1

2014-08-05: Conyers. Dingell both win

2014-08-05: Mike Bishop beats Tom McMillin in 8th Congressional GOP primary t.co/FY1Ny1GVv…

2014-08-05: Still tight in MI14 with 44% in: Brenda Lawrence: 39 percent Rudy Hobbs: 39 percent Hansen Clarke: …

2014-08-05: With 26% reporting, Prop 1 holds 69% approval

2014-08-05: More votes are in: Maturen takes the lead, Hoadley holds on and so does Iden

2014-08-05: And finally, Brandt Iden is leading Phil Stinchcomb 53-47, with 40% reporting.

2014-08-05: It’s a close one in Jase Bolger’s district: Vic Potter is leading Dave Maturen by 84 votes. 76% …

2014-08-05: In Kalamazoo county, Jon Hoadley is leading Dave Buskirk 66-22, with 77% in

2014-08-05: And Trott beats Bentivolio by nearly 2⁄3 margin

2014-08-05: RT: @MIRSnews: MIRS calls: @MikeBishopMI will win the GOP primary in the 8th Congressional primary. …

2014-08-05: Now with 17% in, Prop 1 winning 69-31

2014-08-05: On Election Night, I will forever call Mountain Dew “Dewey” It will not defeat me

2014-08-05: And AP calls MI7 for Tim Walberg, who beat Douglas North Radcliff by nearly 80% …

2014-08-05: With 8% in for Prop 1 The yeses are leading 68-32

2014-08-05: AP calls it for @RepFredUpton #miprimary

2014-08-05: With 10 percent in: Moolenaar - 50 percent Mitchell - 40 percent Konetchy - 10 percent

2014-08-05: With 21 percent in: Amash: 56 percent Brian Ellis: 44 percent

2014-08-05: At least, I hope, if anything tonight, Republicans running against Republicans and Democrats against …

2014-08-05: And why are my parents Facetiming me on election night?

2014-08-05: And I followed it MT: @jonathanoosting: AP called it RT @DavidEggert00: Benishek defeats Arcand in …

2014-08-05: From the AP: Dan Benishek, GOP, nominated U.S. House, District 1, Michigan.

2014-08-05: MI08 update, with 27% DEM: Grettenberger: 44% Schertzing: 31% Darga: 14% Hank: 11% GOP Bishop: 57% …

2014-08-05: In #MI11, now with 24% votes in: Lawrence: 41% Hobbs: 39% Clarke: 19% Foster: 1%

2014-08-05: In #MI4 and 7% reporting: Moolenaar 51% Mitchell 40% Konetchy 10%

2014-08-05: With 6% in Justin Amash is 54-46 over Brian Ellis #miprimary

2014-08-05: With 4% in, Benishek leading Arcand 69-31

2014-08-05: Here’s the latest from AP on #mi11 17 of 304 precincts - 6 percent Dave Trott 18,906 - 66 percent …

2014-08-05: 1st call of the night RT: @MIRSnews: MIRS calls: @trott4congress wins the 11th District Republican …

2014-08-05: On the Dem side, Susan Grettenberger has 49%, with 4 percent of the vote in

2014-08-05: OK, early results are coming in. With 2 percent of the votes in, Mike Bishop has a lead over …

2014-08-05: Real time #miprimary results are here on @MLive t.co/5lrkCoyE3…

2014-08-05: First @ap update of the #miprimary A blank slate on Prop 1 t.co/MAHY2Pgs2…

2014-08-05: FIRST RESULTS t.co/jn6qEIlWo…

2014-08-05: While I’m not covering races in Kalamazoo, I still have county commission results in my tab. …

2014-08-05: Their primaries were all uncontested, BTW #miprimary

2014-08-05: BREAKING: With 0% in, @MLive projects @Peters4Michigan @TerriLLand @MarkSchauer @onetoughnerd all …

2014-08-05: Polls. Are. Closed. Except in 4 Upper Peninsula counties #miprimaries

2014-08-05: True MT: @MTowerSaginaw: I’d say the #mi04 race between @PaulMitchell4us and @JohnMoolenaar …

2014-08-05: So, what elections are on the top of everyone’s list tonight? #miprimaries

2014-08-05: Thinking about how this #miprimary could be different: GOP and Dem #misen races, Conyers running as …

2014-08-05: It’s @NewsroomPizza time #miprimary t.co/XSPJa5bJZ…

2014-08-05: Also, really exciting to have real-time election results on @MLive tonight. All cong, state house …

2014-08-05: 82 minutes until polls close #miprimary

2014-08-05: For a small number of MI voters @TerriLLand is on the ballot twice. Only 1 race in competitive. via …

2014-08-05: Hey look – @cspan is running this in prime time. #buzzsohard #miprimaries …

2014-08-05: Election night set up #miprimary t.co/usmHeGc03…

2014-08-05: Alright everyone, I’m going to be tweeting a lot about elections in the next 12 hours or so. Just a …

2014-08-05: Any one know of a good TV station to watch tonight for #miprimary coverage? Wondering what to put on …

2014-08-05: Getting geared up for election night: ate some tacos, took a nap, and now playing with Javascript! …

2014-08-05: Just voted. #28 at my prescient, which is a Lutheran Church (Wisconsin Synod) #miprimary

2014-08-05: Getting ready to go on @cspan Washington Journal in about 15 minutes to talk about #miprimary races.

2014-08-05: Good morning — polls are open for the #miprimary. Here’s everything you need to know about voting …

2014-08-04: What do you think voter turnout will be tomorrow in the Michigan primary?

2014-08-04: .@john_dingell Tomorrow is an election in Michigan. During your time in politics, what has been the …

2014-08-03: B.Y.O.N. (Bring your own network). t.co/lQydcYEtb…

2014-08-03: Had a great time speaking to @MIPAUpstart #mipa2014 tonight. What a great group of young journalists …

2014-08-03: Who needs a good website URL? t.co/8w1sM4qTK…

2014-08-02: 26.5

2014-08-01: This is real… RT: @YahooTech: Please do not call the police department when Facebook is down …

2014-08-01: Would you jaywalk in front of a elected city official?

2014-08-01: Just saw a car drive by with a Florida Tampa Bay Rays plate…

2014-07-31: Walked into a bar. One sign said $5 a pint. Another said $4. All day IPA?

2014-07-31: Guess who’s back… Out with the old. t.co/B5xRsAJ2D…

2014-07-31: A big day in @downtownlansing signage. Brannigan Brothers is back after 2 name changes. …

2014-07-31: .@joestando glad I could hire you, and it was great working together at the @Kzoo_Gazette years …

2014-07-31: As excited as I am for Price, I’m really going to miss AJ

2014-07-29: That moment when you stop at a gas station. Fill up. As the tank tops off, multiple party buses …

2014-07-29: Inbox: Pat Boone endorsing in #MI08 t.co/vbSxzEjZf…

2014-07-29: Every time I’ve been on MSU’s campus alone I’ve gotten terribly lost.

2014-07-29: I am so very much looking forward to seeing Nick Cave and the Bad Seeds tonight.

2014-07-28: Well, I just replied to a read in haiku. That’s a first t.co/FHFNdrqko…

2014-07-28: When having lunch next door to your office (and still connected to WIFI) is it faster to fix …

2014-07-28: At first, I thought this @AP headline was about Deckers. Alas, it is not… but good for …

2014-07-28: Haiku the News: Can you explain Proposal 1 in 17 syllables? t.co/bHXYOPQDk…

2014-07-28: There’s a serious poetry workshop going on in the @mlive_lansing office right now…

2014-07-27: Post rain sunset t.co/WGDEB77ha…

2014-07-27: If anyone wonders, Kalamazoo will have its “area code birthday” in 2098

2014-07-27: I’m at Knights of Columbus (Imlay City, MI) t.co/Q9pyptiq6…

2014-07-27: We are 100 days out from the November midterm election.

2014-07-26: WWJD — What Would Jim (Leyland) Do?

2014-07-26: Seat of the Capitol? t.co/GW5GTrPq8…

2014-07-26: Model T t.co/uTBuLCoUM…

2014-07-26: Could someone give me a reason to try the Swarm app again? I really miss the old Foursquare.

2014-07-26: Earlier this month, I joined @Peters4Michigan on the campaign trail. Here’s my story from the day: …

2014-07-25: You know it’s a late night in the office when you start composing Proposal 1 haikus with …

2014-07-25: I was writing a sentence about John Moolenaar’s endorsements in the primary when I received an …

2014-07-24: Here’s more on @SchuetteOnDuty’s letter to Enbridge about its Straits of Mackinac pipelines being …

2014-07-24: .@SchuetteOnDuty says Enbridge pipeline in Straits of Mackinac not in compliance with Michigan …

2014-07-24: The @MichiganDems filed 2 complains against @TerriLLand in #MISEN election: t.co/HQaGXfwVl…

2014-07-24: Just a pogo stick on the side of the road t.co/wA7kQgJvK…

2014-07-23: I take a lot of pictures of the Capitol, but this is one of my favorites. @ Michigan State Capitol …

2014-07-23: The personal property tax GIF Michigan has been waiting for: t.co/8MHm8Jg9T…

2014-07-22: Every once and a while I get “Blurred Lines” stuck in my head. Now it’s “Word Crimes” Thank you …

2014-07-21: You know you’ve been doing too much with politics when you write “poll party” instead of “pool …

2014-07-20: Great day for a Klug reunion.

2014-07-19: The Capitol lawn is crowded: 2 separate wedding couples are having their pictures taken and 3 MSP …

2014-07-19: Found a place open in the Stadium district. Thanks @jgoldstrass!

2014-07-19: Downtown Lansing, where there isn’t a coffee shop open on a Saturday.

2014-07-18: I wonder who Larry is, and which Senate he is running for t.co/blbeWEZkc…

2014-07-18: Here is video from the Lansing immigration protest at the Capitol today t.co/scmv3sqye…

2014-07-18: There was little listening being done beyond the four letter words and four word statements.

2014-07-18: People were lined up facing off with one another. Police were in the middle. They screamed at one …

2014-07-18: The other group shouted their counterparts were racist, Nazis and homosexuals.

2014-07-18: One group shouted that they have done more for the country than others.

2014-07-18: There is a major immigration protest down at the Capitol. Many hateful words being said

2014-07-18: A woman was arrested and the group started the USA chant.

2014-07-18: I cannot begin to describe the scene at the Capitol. Groups yelling at each other. Lots of tension. …

2014-07-18: Well, this is big. t.co/aIIqqsnOf…

2014-07-18: One of the best subject lines ever in my inbox. Good work @AP t.co/C9aCggZ6i…

2014-07-15: This RSS feed is normally quiet, but tonight… t.co/RnXBCYafX…

2014-07-15: Trouts and Trotts, it’s a late night.

2014-07-15: Baseball, CFRs and Prince…

2014-07-15: Totally forgot Instagram had a private messaging service. Does anyone use it?

2014-07-15: An unfinished portrait. @ Lansing, Michigan t.co/SqTZBDjow…

2014-07-15: The remains of @CGMusicFest at the River Trail t.co/KmHcR5pvF…

2014-07-14: The 4 Democratic candidates in #mi08 have formed “an unorthodox campaign alliance” — They will …

2014-07-13: Hearing a 16-year-old cover “Blurred Lines” … #cgmf

2014-07-13: I’ve seen two performances so far tonight and each one performed a Stevie Wonder song. I hope this …

2014-07-13: The sawdust is pretty soaked through at Common Ground t.co/tN20DGszE…

2014-07-12: Great crowd tonight at @CGMusicFest t.co/8eIxwpwUo…

2014-07-12: There is this one lightning big that is dancing his little bulb off during the @dalejrjrmusic show …

2014-07-12: Alright let’s do this again @dalejrjrmusic t.co/lNqlH61f1…

2014-07-12: Looking forward to hearing @FitzAndTantrums at @CGMusicFest — I often am mistakenly called Fitz, so …

2014-07-11: Trying to figure out where to go for lunch. I don’t know if an issue has made me any more anxious …

2014-07-09: .@311, the concert was in Lansing. t.co/a9jdprpP7…

2014-07-09: So it looks like the 311 shirt is official. Still don’t know why they are saying the concert is in …

2014-07-09: Saw a custom 311 shirt with the date of the concert tonight. However it says it is in East Lansing. …

2014-07-09: Common Ground baby t.co/6JphZUQvV…

2014-07-08: Perosnal best! I just scored 29,082 in @ThreesGame! t.co/k5Ca6NFJz… t.co/az12aUfUY…

2014-07-08: I need a sippy cup

2014-07-07: Lansing power t.co/FXzyHts0D… t.co/5sVItre6r…

2014-07-07: One time I bought Men 50+ vitamins thinking there were more than 50 kinds of nutrients in each pill. …

2014-07-07: Last night I was woken up by loud noises and flashes — didn’t know if they were fireworks or thunder …

2014-07-07: It’s always a little strange quoting someone in a story with the last name Fritz. “said Fritz” …

2014-07-07: Remember: Today is the last day to register to vote for the August primary election: …

2014-07-06: I just fully realized I was raised using computers when I put an @OmniFocus reminder every month to …

2014-07-06: I can’t believe I’ve just listened to “Here Lies Love” — what an amazing album

2014-07-06: Enjoying my first @LansingLugnuts game of the year. Nothing like baseball on a lazy Sunday …

2014-07-05: Best protect your neck. t.co/0JQLe4TQn…

2014-07-05: Here comes Common Ground t.co/Ctt8Ddj9Z…

2014-07-04: It’s that time. Independence Day. t.co/psmRJANyn…

2014-07-04: Drinking root beer straight from the growler. What’s the cup for? To bump up the jams. …

2014-07-04: Every time I see a jet ski I think of Kenny Powers.

2014-07-04: One of the coolest things to see on the Fourth of July t.co/iMBTJac6r…

2014-07-04: I feel like a @PureMichigan photo was taken here… t.co/ZzSjbTMI3…

2014-07-04: . @weathermanmark was right on — this is the perfect Fourth of July weather!

2014-07-04: Happy Fourth of July! t.co/FGqU6jYLu…

2014-07-03: I think it’s time to leave for the holiday weekend.

2014-07-03: Today, I installed an OSX update and it crashed my Mac.

2014-07-03: Yesterday I installed an iOS update and it crashed my phone.

2014-07-03: But @MichiganGonzo my mom is doing it right: RT: @deb_klug: @ShortsBrewing @fritzklug We made it ! …

2014-07-03: Guess where I am @MichiganGonzo t.co/Y1AlFMF0V…

2014-07-03: An app I use every day RT: @MacStoriesDeals: Day One: $4.99 > Free t.co/NwAz3k7CP… …

2014-07-01: Stopped by to see the road named after my family in Romulus. Didn’t know there was an old one. …

2014-06-30: Yes Rajai Raj!!!! RT: @tigers: THIRD CAREER GRAND SLAM! FIRST #WALKOFF!! @rajai11davis

2014-06-30: So, is this bird warning me there is a storm coming? t.co/uYu3Fm6o3…

2014-06-30: These clouds were blowing in fast t.co/UJ2aBJrNO…

2014-06-30: Watch out Michigan, Aeolus is coming our way.

2014-06-28: Finally decided to turn on the air conditioner. What was I thinking not using it before?

2014-06-27: It’s always sad to see empty ballparks on TV…

2014-06-26: I thought we were having BBQ, @MichiganGonzo #mibest t.co/awFw9KN9O…

2014-06-25: A foggy day in Lansing town. @ Michigan State Capitol t.co/ziVhK2Mb1…

2014-06-24: .@MikeBishopMI says Obama thinks “the Constitution is a revisable Word document.”

2014-06-24: Now it’s time for the Republican half of the forum. Starting at 9 pm, yes, it’s going to be a late …

2014-06-24: There’s a few people here holding camcorders…

2014-06-24: Following the candidate forum tonight for #mi08 in Howell. First, it’s the four Democrats. Then …

2014-06-24: Covering my first candidate forum of the year!!!!!! t.co/f3EfrwugD…

2014-06-24: .@SenWarren to campaign for @Peters4Michigan in July #misen

2014-06-24: SAY WHAT?! RT: @van_stratt: The day Marvin Gaye was almost a Detroit Lion | t.co/D60MfX99B… …

2014-06-24: Feat. Carl Levin of Michigan RT: @frankthorpNBC: So this happened at the Congressional Gold Medal …

2014-06-24: The big question today is how a Jo Ann Fabric’s cart found it’s way downtown. t.co/JQhGjImKp…

2014-06-24: How much did it rain? See the Meijer parking lot. t.co/5BTIjo2mt…

2014-06-23: Can’t wait to catch game 5 of the 1984 @tigers World Series tonight. t.co/EX82AOyPh…

2014-06-22: So many #tigers fans at the rest stops.

2014-06-22: Yup, my dad and I were those guys who drove around Cleveland after the game and played this. Had a …

2014-06-22: SWEEP!

2014-06-22: OH at Progressive Field from an @indians fan: “This isn’t a game. It’s batting practice.” #GoTigers

2014-06-22: The power of Detroit music.

2014-06-22: So a play is under review for the Tigers and they play Jack White? Thanks for the good karma, …

2014-06-22: Kinsler’s foul almost his a seagull. Almost

2014-06-22: Hold them Tigers, they say #GoTigers t.co/YXpl7G0ZX…

2014-06-22: Game 3 starts off good with the Zelda theme!

2014-06-21: Only in baseball will you play your rival, have it be a close game, lose in overtime and then have …

2014-06-21: UPDATE: she was!

2014-06-21: My mom just said Phil Coke is hot. Really hope she was referring to his arm…

2014-06-21: Good words tonight. t.co/shIq6co9Q…

2014-06-21: Great view for night 2. #GoTigers t.co/7jiYKp7r6…

2014-06-21: I think they just played the “Imperial March” when introducing the @tigers.

2014-06-21: .@mario_impemba @RodAllen12 — my mom @deb_klug was excited to bring this sign to tonight’s @tigers …

2014-06-20: Not dancing to “Jump on it” is really hard. #GoTigers

2014-06-20: Too many rally caps for comfort.

2014-06-20: So we just scored a bunch of runs. And Cleveland plays some Bob Seeger. #yup

2014-06-20: I just saw Miggy steal a base, and be Miggy.

2014-06-20: Wow, there’s news from Detroit two nights in a row.

2014-06-20: And now fans are doing the “yes” chant?

2014-06-20: Really Cleveland, you are going to play White Stripes to pump your fans up playing against the …

2014-06-20: We keep moving west: Great graphic from the @uscensusbureau on how Americans migrate …

2014-06-20: Any suggestions on things to do before a Cleveland Indians game? via @jelly t.co/ISF3RYln0…

2014-06-19: Steam has built in, 2-factor authentication? Sweet.

2014-06-19: On the road to Cleveland to catch the Tigers series this weekend. @ Commodore Perry Travel Plaza On …

2014-06-19: You know, that day when one of your favorite apps gets a upgrade after years. What a great surprise. …

2014-06-19: Way to go @Tigers! Let’s keep it going in Cleveland!

2014-06-19: .@MLive and here is how Abraham Lincoln coined the term Michigander. t.co/eiYHk6qlh…

2014-06-19: There is no fight or debate. It’s Michigander. RT: @MLive: Important Twitter fight: Michigander or …

2014-06-19: .@DetroitChamber PAC endorsed @Peters4Michigan in #MISEN. They endorsed @onetoughnerd in the …

2014-06-18: Detroit “City Gas Co.: 1913” t.co/maXIoTygi…

2014-06-18: Never saw him perform, but he played Detroit a lot, including in 1960 for the 2nd Annual Detroit …

2014-06-18: RIP Horace Silver

2014-06-18: There was a storm today in Lansing. Here is the gif: t.co/x4o4lroUK…

2014-06-18: A storm is coming to Lansing t.co/4ZVxuo9xc…

2014-06-18: The storm is expected to be rolling through Lansing in the next hour, according to @NWSGrandRapids

2014-06-18: It’s the calm before the storm t.co/VCeeoDqqG… t.co/KDuQ1ZC0J…

2014-06-18: Storm is coming! Charge your devices!

2014-06-18: Updated story on #MISEN debates with @TerriLLand campaign statement: Looking forward to “joint …

2014-06-18: Hey @mcmilzz — we slinged yesterday, how about a “yo” today? t.co/iHNNBKsd7…

2014-06-18: Just now: .@Peters4Michigan is calling for 5 debates with @TerriLLand in #MISEN

2014-06-16: A goal before the first beer? USA! 🇺🇸🇺🇸🇺🇸🇺🇸

2014-06-15: I lost this week’s weight loss competition w/ @MichiganGonzo, but did it eating a cupcake and …

2014-06-14: Does this look like Italy to anyone else? t.co/SXs9ZpzU9…

2014-06-14: All that’s missing here at @TibbsBrewing is @amyonthetrail and @MichiganGonzo t.co/Ldda9JT0u…

2014-06-14: Just saw a wedding party’s photographic dreams crushed when they left the party bus to see the …

2014-06-14: I am really going to miss @TellMeMoreNPR

2014-06-13: Grand Rapids really is the furniture city. t.co/kQAvHyOGT…

2014-06-13: MT: @ChadLivengood: Bolger: “As a proud Bronco and a proud son, I’m very excited Gov. Snyder has …

2014-06-13: RT: @MIRSnews: Governor appoints father of Speaker Bolger to WMU Board of Trustees.

2014-06-13: During the World Cup, do we root for teams in the same continent and hemisphere?

2014-06-12: Had a great hike today. @ Platte River Campground t.co/WMQ9lWHzv…

2014-06-12: I’ve never been to a @meijer on opening day. Everything is so fresh…and they are handing out store …

2014-06-12: Why is this a called a “welcome center?” It’s pretty much in the middle for the …

2014-06-12: I’m at Northern Latitudes Distillery (Lake Leelanau, MI) t.co/jbjtv2Mw9…

2014-06-11: And as soon as my mom called to see how I was doing the power came back on.

2014-06-11: And I just realized I don’t have candles and can’t find my flashlight. Thank goodness I have a …

2014-06-11: Power is out. A lot more quiet when all 7 fans are not blowing. Also learning how much those fans …

2014-06-11: Just realized I have not used the @swarmapp for weeks, even though it is on my home screen. Kinda …

2014-06-10: Hey look who’s on CNN — @petehoekstra t.co/Toa1DcUEo…

2014-06-10: I wonder if Camp or Rogers would have considered reelection if they could have run for leadership in …

2014-06-10: At a play and heard the news during intermission. First thought “Who’s Cantor” Had no idea he had a …

2014-06-10: I just scored 29,082 in @ThreesGame! #vacation t.co/k5Ca6NFJz… t.co/sIrrja5Bf…

2014-06-08: It feels great to watch an awards show and not have to go to work the next morning.

2014-06-08: For the first time I’ve heard Sparks on the radio. t.co/ClzQZ3oOQ…

2014-06-06: As we remember and honor #DDay70 here is how Michigan is connected with the historic battle …

2014-06-06: Time for some fresh fish. (@ Schu’s Grill & Bar) t.co/RFHXk9GHT…

2014-06-06: You know you are in St Joe when you see @RepFredUpton campaign pins in an antique store. …

2014-06-06: My mom @deb_klug has discovered @ShortsBrewing Local’s Light. She’s stocking up. …

2014-06-05: Wish I was on the road with @MichiganGonzo today revisiting some of the #mibest #midonut winners. …

2014-06-04: Yesterday, @MLive began honoring Michiganders who served in WWII. View this list …

2014-06-02: It looks like Deckers will “stay in the area” but no details. t.co/YwLrOE7WT…

2014-06-02: Another more important question: who has the second best coffee downtown Lansing?

2014-06-02: Does anyone know where Deckers got their coffee? The Nicaraguan was one of the best blends.

2014-06-02: 😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭 RT: @jonathanoosting: Just like that, Decker’s is gone from downtown Lansing. …

2014-06-01: Congrats to all my @MLive colleagues! MLive Media Group wins 20 first-place Michigan AP awards …

2014-05-31: .@MichiganGonzo I know, I will start today. Not yesterday. How can you say no to @CopsDoughnuts? …

2014-05-30: Straits of Mackinac hair t.co/NzCZwbpCk…

2014-05-29: .@john_dingell has 4 pieces of advice for anyone elected to U.S. Congress. #1: work like hell …

2014-05-29: Paul Begala says Mich is known for making cars, and really good pieces of bipartisan legislation …

2014-05-29: This place is clearing out at the start of the CNN midterm session. #mpc14 t.co/lwL2P0mKe…

2014-05-29: .@SenCarlLevin says he’s been around @john_dingell and @DebDingell so long he’s started to call his …

2014-05-29: Dingell: Levin has three beautiful daughters, “Made in Michigan” to much applause

2014-05-29: “We’ve relied on our family bond and friendship to move our state forward.” — @john_dingell on …

2014-05-29: Dingell said his family and the Levin’s have been friends for decades.

2014-05-29: On fixing the roads, @onetoughnerd says git ‘r done. #mpc14

2014-05-29: Two Michigan political giants on the Grand Hotel porch. #MPC14 t.co/igQ3HdMfM…

2014-05-29: I made a new taco: double decker double taco #mibest #mitacos @MichiganGonzo t.co/JCurHhzz6…

2014-05-29: Of all days, we are having tacos at #mpc14 t.co/pz3hCk7Ew…

2014-05-29: Carl Levin is on the island #MPC14

2014-05-29: . @Meholland interviews @umich and @michiganstateu presidents #MPC14 t.co/YC7TwGoCi…

2014-05-29: Michigan nonprofits say they stabilized state economy during downturn #MPC14 t.co/vhyoz5x3l…

2014-05-29: .@Gladwell takes the stage at #mpc14, says he feels like he’s in the Great Gatsby …

2014-05-29: And Michigan’s Best Taco is…… t.co/Ovvf8RrSx…

2014-05-28: Sorry, kinda busy #mpc14 t.co/eG9ANohwx…

2014-05-28: . @TerriLLand meets the press. First scrum of the campaign. #mpc14 #MISENnondebate #MISEN …

2014-05-28: Different takes on addressing the crowd: Peters used no notes and walked around. Land had notes and …

2014-05-28: Alas, no Peters-Land photo. Looks like we will have to wait… #MISENnondebate #mpc14

2014-05-28: